1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Epithelial cell CD Proteins Endothelial cell CD Proteins Notch family
  4. Jagged-1/CD339
  5. Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO)

Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO)

Cat. No.: HY-P71633
COA Handling Instructions

Jagged-1/JAG1 protein is a multifunctional ligand that binds to multiple Notch receptors and mediates Notch signaling. It influences cell fate decisions during hematopoiesis, spans early and late mammalian cardiovascular development, and regulates myoblast differentiation. Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Jagged-1/JAG1 protein, expressed by E. coli , with C-Myc, N-SUMO, N-10*His labeled tag. The total length of Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO) is 302 a.a., with molecular weight of ~53.6 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $84 In-stock
10 μg $145 In-stock
50 μg $400 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Jagged-1/JAG1 protein is a multifunctional ligand that binds to multiple Notch receptors and mediates Notch signaling. It influences cell fate decisions during hematopoiesis, spans early and late mammalian cardiovascular development, and regulates myoblast differentiation. Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Jagged-1/JAG1 protein, expressed by E. coli , with C-Myc, N-SUMO, N-10*His labeled tag. The total length of Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO) is 302 a.a., with molecular weight of ~53.6 kDa.

Background

Jagged-1 (JAG1) serves as a versatile ligand, engaging multiple Notch receptors and participating in the mediation of Notch signaling. Its involvement extends to potential roles in cell-fate decisions during hematopoiesis and spans both early and late stages of mammalian cardiovascular development. Moreover, JAG1 demonstrates the ability to modulate myoblast differentiation, emphasizing its regulatory impact on diverse cellular processes. Additionally, it may play a role in the regulation of fibroblast growth factor-induced angiogenesis. Through its interactions with NOTCH1, NOTCH2, and NOTCH3, JAG1 contributes to the complex orchestration of Notch signaling, highlighting its significance in cellular responses and developmental pathways.

Species

Mouse

Source

E. coli

Tag

C-Myc;N-SUMO;N-10*His

Accession

Q9QXX0 (33G-334E)

Gene ID

16449  [NCBI]

Molecular Construction
N-term
10*His-SUMO
JAG1 (33G-334E)
Accession # Q9QXX0
C-term
Synonyms
Jag1; Protein jagged-1; Jagged1; CD antigen CD339
AA Sequence

GQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCE

Molecular Weight

Approximately 53.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4 or 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO)
Cat. No.:
HY-P71633
Quantity:
MCE Japan Authorized Agent: