Copy Link Print Information

Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Jagged-1/JAG1 protein is a multifunctional ligand that binds to multiple Notch receptors and mediates Notch signaling.It influences cell fate decisions during hematopoiesis, spans early and late mammalian cardiovascular development, and regulates myoblast differentiation.Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Jagged-1/JAG1 protein, expressed by E.coli , with C-Myc, N-SUMO, N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Jagged-1/JAG1 protein is a multifunctional ligand that binds to multiple Notch receptors and mediates Notch signaling.It influences cell fate decisions during hematopoiesis, spans early and late mammalian cardiovascular development, and regulates myoblast differentiation.Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Jagged-1/JAG1 protein, expressed by E.coli , with C-Myc, N-SUMO, N-10*His labeled tag.

Background

Jagged-1 (JAG1) serves as a versatile ligand, engaging multiple Notch receptors and participating in the mediation of Notch signaling. Its involvement extends to potential roles in cell-fate decisions during hematopoiesis and spans both early and late stages of mammalian cardiovascular development. Moreover, JAG1 demonstrates the ability to modulate myoblast differentiation, emphasizing its regulatory impact on diverse cellular processes. Additionally, it may play a role in the regulation of fibroblast growth factor-induced angiogenesis. Through its interactions with NOTCH1, NOTCH2, and NOTCH3, JAG1 contributes to the complex orchestration of Notch signaling, highlighting its significance in cellular responses and developmental pathways.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-Myc;N-SUMO;N-10*His
  • Accession

    Q9QXX0 (G33-E334)

  • Gene ID
    16449  [NCBI]
  • Molecular Construction
    • N-term
    • 10*His-SUMO
    • JAG1 (G33-E334)
      Accession # Q9QXX0
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    JAG1; Jagged 1; Prev. JAGL1; Alagille Syndrome; Prev. AGS; Jagged-1 Protein; HJ1; CD339 Antigen; CD339; Jagged1; AHD; CMT2HH; AWS; AGS1; Protein Jagged-1; DCHE; Jagged Canonical Notch Ligand 1; Delta-Like Protein

  • AA Sequence

    GQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCE

  • Predicted Molecular Mass

    53.6 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4 or 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO) Product Image
    1/16
  • Jagged-1/JAG1 Protein, Mouse (Myc, His-SUMO) Product Image