1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Kallikrein-11 Protein, Human (HEK293, His)

Kallikrein-11 protein is suggested to be a multifunctional protease, efficiently cleaving the substrate 'bz-Phe-Arg-4-methylcoumaryl-7-amide' and showing weak cleavage activity toward other kallikrein and trypsin substrates. It predominantly cleaves synthetic peptides after arginine residues rather than lysine residues. Kallikrein-11 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-11 protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Kallikrein-11 protein is suggested to be a multifunctional protease, efficiently cleaving the substrate 'bz-Phe-Arg-4-methylcoumaryl-7-amide' and showing weak cleavage activity toward other kallikrein and trypsin substrates. It predominantly cleaves synthetic peptides after arginine residues rather than lysine residues. Kallikrein-11 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-11 protein, expressed by HEK293 , with C-His labeled tag.

Background

Kallikrein-11 protein is speculated to be a potential multifunctional protease. It has been shown to efficiently cleave a kallikrein substrate called 'bz-Phe-Arg-4-methylcoumaryl-7-amide' and exhibits weak cleavage activity towards other substrates for kallikrein and trypsin. Notably, it primarily cleaves synthetic peptides after arginine residues rather than lysine residues.

Biological Activity

Measured by its ability to cleave a colorimetric peptide substrate D-Val-Leu-Lys-ThioBenzyl ester (VLK-SBzl), in the presence of 5,5'Dithio-bis (2-nitrobenzoic acid) (DTNB) (Edwards, K.M. et al.,1999, J. Biol. Chem. 274: 30468) . The specific activity is >200 pmol/min/μg. (Activation description: The proenzyme needs to be activated by Thermolysin for an activated form.)

Species

Human

Source

HEK293

Tag

C-His

Accession

Q9UBX7-1 (E19-N250)

Gene ID
Molecular Construction
N-term
Kallikrein-11 (E19-N250)
Accession # Q9UBX7-1
His
C-term
Protein Length

Partial

Synonyms
Kallikrein-11; TLSP; hK11; Hippostasin; Trypsin-like protease; Serine protease 20
AA Sequence

ETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN

분자량

Approximately 40 kDa

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

Kallikrein-11 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Kallikrein-11 Protein, Human (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Kallikrein-11 Protein, Human (HEK293, His)
Cat. No.:
HY-P73263
수량:
MCE Japan Authorized Agent: