1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Kallikrein-7 Protein, Mouse (HEK293, His)

Kallikrein-7 is an important contributor to skin integrity and may catalyze the degradation of intercellular adhesive structures that are critical for continuous cell shedding.Kallikrein-7 exhibits cleavage activity against insulin A and B chains, with specificity for aromatic residues at position P1 indicating versatility in substrate recognition.Kallikrein-7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kallikrein-7 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Kallikrein-7 is an important contributor to skin integrity and may catalyze the degradation of intercellular adhesive structures that are critical for continuous cell shedding.Kallikrein-7 exhibits cleavage activity against insulin A and B chains, with specificity for aromatic residues at position P1 indicating versatility in substrate recognition.Kallikrein-7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kallikrein-7 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The Kallikrein-7 protein emerges as a significant contributor to the maintenance of skin integrity, potentially catalyzing the degradation of intercellular cohesive structures within the cornified layer. This activity is likely crucial for the continuous shedding of cells from the skin surface. With a specificity for amino acid residues featuring aromatic side chains in the P1 position, Kallikrein-7 exhibits cleavage activity on insulin A and B chains at specific residues, suggesting its versatility in substrate recognition. Moreover, the protein could play a role in the activation of precursors to inflammatory cytokines, implying a potential involvement in the regulation of inflammatory processes. The multifaceted functions of Kallikrein-7 underscore its importance in skin physiology and its potential contributions to both structural integrity and inflammatory responses, warranting further exploration into its specific molecular mechanisms.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q91VE3 (Q22-R249)

Gene ID
Molecular Construction
N-term
Kallikrein-7 (Q22-R249)
Accession # Q91VE3
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Kallikrein-7; Klk7; Serine protease 6; Stratum corneum chymotryptic enzyme; Thymopsin; kallikrein-related peptidase 7; PRSS6; SCCEkallikrein-7
AA Sequence

QGERIIDGYKCKEGSHPWQVALLKGNQLHCGGVLVDKYWVLTAAHCKMGQYQVQLGSDKIGDQSAQKIKATKSFRHPGYSTKTHVNDIMLVRLDEPVKMSSKVEAVQLPEHCEPPGTSCTVSGWGTTTSPDVTFPSDLMCSDVKLISSRECKKVYKDLLGKTMLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYKRWVMETMKTHR

Predicted Molecular Mass
26.1 kDa
Molecular Weight

Approximately 28-35 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Kallikrein-7 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Kallikrein-7 Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Kallikrein-7 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70883
Quantity:
MCE Japan Authorized Agent: