1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Kallikrein-7 Protein, Mouse (HEK293, His)

Kallikrein-7 Protein, Mouse (HEK293, His)

Cat. No.: HY-P70883
Handling Instructions

Kallikrein-7 is an important contributor to skin integrity and may catalyze the degradation of intercellular adhesive structures that are critical for continuous cell shedding. Kallikrein-7 exhibits cleavage activity against insulin A and B chains, with specificity for aromatic residues at position P1 indicating versatility in substrate recognition. Kallikrein-7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kallikrein-7 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Kallikrein-7 Protein, Mouse (HEK293, His) is 228 a.a., with molecular weight of 28-35 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Kallikrein-7 is an important contributor to skin integrity and may catalyze the degradation of intercellular adhesive structures that are critical for continuous cell shedding. Kallikrein-7 exhibits cleavage activity against insulin A and B chains, with specificity for aromatic residues at position P1 indicating versatility in substrate recognition. Kallikrein-7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kallikrein-7 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Kallikrein-7 Protein, Mouse (HEK293, His) is 228 a.a., with molecular weight of 28-35 kDa.

Background

The Kallikrein-7 protein emerges as a significant contributor to the maintenance of skin integrity, potentially catalyzing the degradation of intercellular cohesive structures within the cornified layer. This activity is likely crucial for the continuous shedding of cells from the skin surface. With a specificity for amino acid residues featuring aromatic side chains in the P1 position, Kallikrein-7 exhibits cleavage activity on insulin A and B chains at specific residues, suggesting its versatility in substrate recognition. Moreover, the protein could play a role in the activation of precursors to inflammatory cytokines, implying a potential involvement in the regulation of inflammatory processes. The multifaceted functions of Kallikrein-7 underscore its importance in skin physiology and its potential contributions to both structural integrity and inflammatory responses, warranting further exploration into its specific molecular mechanisms.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q91VE3 (Q22-R249)

Gene ID

23993  [NCBI]

Molecular Construction
N-term
Kallikrein-7 (Q22-R249)
Accession # Q91VE3
6*His
C-term
Synonyms
Kallikrein-7; Klk7; Serine protease 6; Stratum corneum chymotryptic enzyme; Thymopsin; kallikrein-related peptidase 7; PRSS6; SCCEkallikrein-7
AA Sequence

QGERIIDGYKCKEGSHPWQVALLKGNQLHCGGVLVDKYWVLTAAHCKMGQYQVQLGSDKIGDQSAQKIKATKSFRHPGYSTKTHVNDIMLVRLDEPVKMSSKVEAVQLPEHCEPPGTSCTVSGWGTTTSPDVTFPSDLMCSDVKLISSRECKKVYKDLLGKTMLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYKRWVMETMKTHR

Molecular Weight

28-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Kallikrein-7 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Kallikrein-7 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70883
Quantity:
MCE Japan Authorized Agent: