KCIP-1 Protein, Mouse (P.pastoris, His)
Based on 1 Customer Validation
KCIP-1 protein serves as the linker of TNFRSF1A/TNFR1 and mediates its interaction with FADD. Overexpression induces TNF-induced responses: apoptosis and NF-κ-B activation. KCIP-1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived KCIP-1 protein, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Mouse
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
KCIP-1 protein serves as the linker of TNFRSF1A/TNFR1 and mediates its interaction with FADD. Overexpression induces TNF-induced responses: apoptosis and NF-κ-B activation. KCIP-1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived KCIP-1 protein, expressed by P. pastoris , with N-6*His labeled tag.
Background
TRADD functions as an adapter molecule for TNFRSF1A/TNFR1, forming a complex with the activated TNFRSF1A/TNFR1 and mediating its interaction with FADD. Overexpression of TRADD induces two major TNF-induced responses: apoptosis and activation of NF-kappa-B. The nuclear form of TRADD acts as a tumor suppressor by preventing ubiquitination and degradation of isoform p19ARF/ARF of CDKN2A through interaction with TRIP12, disrupting the interaction between TRIP12 and isoform p19ARF/ARF of CDKN2A. Stimulation of TNFRSF1A leads to the formation of two distinct signaling complexes. Plasma membrane-bound complex I, composed of TNFRSF1A, TRADD, RIPK1, TRAF2, and BIRC2/c-IAP1 or BIRC3, interacts with CHUCK/IKK-alpha, IKBKB/IKK-beta, and IKBKG/IKK-gamma, promoting cell survival. Subsequently, TRADD, RIPK1, and TRAF2 dissociate from TNFRSF1A and form cytoplasmic complex II with FADD and caspase CASP8, promoting cell apoptosis. TRADD interacts with various proteins within complex I, including TNFRSF1A/TNFR1, TRAF2, kinase RIPK1, TRPC4AP, and scaffold protein DAB2IP. It also interacts with autophagy receptor SQSTM1, E3 ligase TRIP12, kinase HIPK2, and keratins KRT14, KRT18, KRT16, and KRT17. Additionally, TRADD interacts with TOMM70.
Technical Parameters
-
Species Mouse
-
Source P. pastoris
-
Tag N-6*His
-
Accession
Q9CQV8-1 (M1-N246)
-
Molecular Construction
-
N-term
-
6*His
-
KCIP-1 (M1-N246)
Accession # Q9CQV8-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
YWHAB; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein Beta; YWHAA; 14-3-3 Protein Beta/Alpha; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein; Alpha Polypeptide; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxyg
-
AA Sequence
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
-
Predicted Molecular Mass
30.1 kDa
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS,6% Trehalose, pH 7.4 or 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
