1. Recombinant Proteins
  2. Others
  3. KIAA0101 Protein, Human (His)

KIAA0101 Protein, Human (His)

Cat. No.: HY-P75900
COA Handling Instructions

The KIAA0101 protein is a PCNA-binding regulator that plays a key role in DNA repair during replication. After DNA damage, it disrupts its interaction with PCNA and promotes the binding between monoubiquitinated PCNA and DNA polymerase eta (POLH). KIAA0101 Protein, Human (His) is the recombinant human-derived KIAA0101 protein, expressed by E. coli , with N-His labeled tag. The total length of KIAA0101 Protein, Human (His) is 111 a.a., with molecular weight of ~17 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $70 In-stock
10 μg $110 In-stock
50 μg $290 In-stock
100 μg $465 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The KIAA0101 protein is a PCNA-binding regulator that plays a key role in DNA repair during replication. After DNA damage, it disrupts its interaction with PCNA and promotes the binding between monoubiquitinated PCNA and DNA polymerase eta (POLH). KIAA0101 Protein, Human (His) is the recombinant human-derived KIAA0101 protein, expressed by E. coli , with N-His labeled tag. The total length of KIAA0101 Protein, Human (His) is 111 a.a., with molecular weight of ~17 kDa.

Background

KIAA0101 Protein, a PCNA-binding protein, plays a pivotal role as a DNA repair regulator during DNA replication. Upon DNA damage, its interaction with PCNA is disrupted, promoting the association between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes. This interaction facilitates the bypass of replication-fork-blocking lesions, ensuring the continuity of DNA replication under challenging conditions. Beyond its involvement in DNA repair processes, KIAA0101 also functions as a regulator of centrosome number. The protein interacts with PCNA, particularly when monoubiquitinated at Lys-15 and Lys-24, and additionally forms associations with isoform 2/p33ING1b of ING1 and BRCA1, suggesting its participation in diverse cellular pathways.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q15004-1 (M1-E111)

Gene ID
Molecular Construction
N-term
His
KIAA0101 (M1-E111)
Accession # Q15004
C-term
Synonyms
PCNA-associated factor; OEATC-1; PAF15; p15PAF; PCLAF; KIAA0101; NS5ATP9; PAF
AA Sequence

MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

Molecular Weight

Approximately 17 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

KIAA0101 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KIAA0101 Protein, Human (His)
Cat. No.:
HY-P75900
Quantity:
MCE Japan Authorized Agent: