KIAA0101 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The KIAA0101 protein is a PCNA-binding regulator that plays a key role in DNA repair during replication. After DNA damage, it disrupts its interaction with PCNA and promotes the binding between monoubiquitinated PCNA and DNA polymerase eta (POLH). KIAA0101 Protein, Human (His) is the recombinant human-derived KIAA0101 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The KIAA0101 protein is a PCNA-binding regulator that plays a key role in DNA repair during replication. After DNA damage, it disrupts its interaction with PCNA and promotes the binding between monoubiquitinated PCNA and DNA polymerase eta (POLH). KIAA0101 Protein, Human (His) is the recombinant human-derived KIAA0101 protein, expressed by E. coli , with N-His labeled tag.

Background

KIAA0101 Protein, a PCNA-binding protein, plays a pivotal role as a DNA repair regulator during DNA replication. Upon DNA damage, its interaction with PCNA is disrupted, promoting the association between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes. This interaction facilitates the bypass of replication-fork-blocking lesions, ensuring the continuity of DNA replication under challenging conditions. Beyond its involvement in DNA repair processes, KIAA0101 also functions as a regulator of centrosome number. The protein interacts with PCNA, particularly when monoubiquitinated at Lys-15 and Lys-24, and additionally forms associations with isoform 2/p33ING1b of ING1 and BRCA1, suggesting its participation in diverse cellular pathways.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • KIAA0101 (M1-E111)
      Accession # Q15004
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    PCLAF; Overexpressed In Anaplastic Thyroid Carcinoma 1; Prev. KIAA0101; PCNA-Clamp-Associated Factor; PCNA-Associated Factor; P15PAF; NS5ATP9; PAF; OEATC-1; P15/PAF; PAF15; OEATC1; PCNA-Associated Factor Of 15 KDa; OEATC; P15(PAF); L5; Hepatitis C Virus N

  • AA Sequence

    MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00