KIAA0101 Protein, Human (His)
Based on 1 Customer Validation
The KIAA0101 protein is a PCNA-binding regulator that plays a key role in DNA repair during replication. After DNA damage, it disrupts its interaction with PCNA and promotes the binding between monoubiquitinated PCNA and DNA polymerase eta (POLH). KIAA0101 Protein, Human (His) is the recombinant human-derived KIAA0101 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The KIAA0101 protein is a PCNA-binding regulator that plays a key role in DNA repair during replication. After DNA damage, it disrupts its interaction with PCNA and promotes the binding between monoubiquitinated PCNA and DNA polymerase eta (POLH). KIAA0101 Protein, Human (His) is the recombinant human-derived KIAA0101 protein, expressed by E. coli , with N-His labeled tag.
Background
KIAA0101 Protein, a PCNA-binding protein, plays a pivotal role as a DNA repair regulator during DNA replication. Upon DNA damage, its interaction with PCNA is disrupted, promoting the association between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes. This interaction facilitates the bypass of replication-fork-blocking lesions, ensuring the continuity of DNA replication under challenging conditions. Beyond its involvement in DNA repair processes, KIAA0101 also functions as a regulator of centrosome number. The protein interacts with PCNA, particularly when monoubiquitinated at Lys-15 and Lys-24, and additionally forms associations with isoform 2/p33ING1b of ING1 and BRCA1, suggesting its participation in diverse cellular pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q15004-1 (M1-E111)
-
Molecular Construction
-
N-term
-
His
-
KIAA0101 (M1-E111)
Accession # Q15004 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PCLAF; Overexpressed In Anaplastic Thyroid Carcinoma 1; Prev. KIAA0101; PCNA-Clamp-Associated Factor; PCNA-Associated Factor; P15PAF; NS5ATP9; PAF; OEATC-1; P15/PAF; PAF15; OEATC1; PCNA-Associated Factor Of 15 KDa; OEATC; P15(PAF); L5; Hepatitis C Virus N
-
AA Sequence
MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
