KIR2DL3 Protein, Human (HEK293, His)

KIR2DL3, found on NK cells, selectively recognizes HLA-C alleles like HLA-Cw1, HLA-Cw3, and HLA-Cw7. Its interaction leads to inhibitory effects, preventing NK cell activity and cell lysis. KIR2DL3's association with ARRB2 underscores its role in cellular signaling pathways, intricately modulating NK cell functions. KIR2DL3 Protein, Human (HEK293, His) is the recombinant human-derived KIR2DL3 protein, expressed by HEK293 , with C-6*His labeled tag.

KIR2DL3, expressed on natural killer (NK) cells, functions as a receptor specifically recognizing HLA-C alleles, such as HLA-Cw1, HLA-Cw3, and HLA-Cw7. Through this interaction, KIR2DL3 exerts inhibitory effects on NK cell activity, playing a crucial role in preventing cell lysis. The receptor further engages with ARRB2, highlighting its involvement in intricate cellular signaling pathways that modulate NK cell functions.

Human

HEK293

C-6*His

P43628-1 (H22-H245)

3804  [NCBI]

Extracellular Domain

HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Approximately 35-50 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.