KIR2DL5/CD158f Protein, Human (HEK293, Fc)

KIR2DL5/CD158f, present on NK cells, acts as a receptor for HLA-C alleles. Its inhibitory function finely tunes NK cell activity, preventing cell lysis by interacting with specific HLA-C molecules. This dynamic engagement contributes to the nuanced balance of inhibitory signals in the immune system, regulating NK cell responses to potential targets. KIR2DL5/CD158f Protein, Human (HEK293, Fc) is the recombinant human-derived KIR2DL5/CD158f protein, expressed by HEK293 , with C-hFc labeled tag. The total length of KIR2DL5/CD158f Protein, Human (HEK293, Fc) is 219 a.a., with molecular weight of ~50.3 KDa.

KIR2DL5/CD158f, expressed on natural killer (NK) cells, functions as a receptor for HLA-C alleles. This receptor operates in an inhibitory manner, regulating NK cell activity to prevent cell lysis. By interacting with specific HLA-C molecules, KIR2DL5 contributes to the delicate balance of inhibitory signals in the immune system, fine-tuning the response of NK cells to potential targets.

Immobilized Human KIR2DL5 at 2 μg/mL (100 μL/well) can bind Anti- KIR2DL5 Antibody. The ED₅₀ for this effect is 1.558 μg/mL.

Human

HEK293

C-hFc

Q8N109/NP_065396.1 (H22-H240)

57292  [NCBI]

HEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH

Approximately 65 kDa due to the glycosylation

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.