1. Recombinant Proteins
  2. Receptor Proteins
  3. Killer-Cell Immunoglobulin-like Receptors
  4. KIR2DL5
  5. KIR2DL5/CD158f Protein, Human (HEK293, Fc)

KIR2DL5/CD158f Protein, Human (HEK293, Fc)

Cat. No.: HY-P77041
SDS COA Handling Instructions

KIR2DL5/CD158f, present on NK cells, acts as a receptor for HLA-C alleles. Its inhibitory function finely tunes NK cell activity, preventing cell lysis by interacting with specific HLA-C molecules. This dynamic engagement contributes to the nuanced balance of inhibitory signals in the immune system, regulating NK cell responses to potential targets. KIR2DL5/CD158f Protein, Human (HEK293, Fc) is the recombinant human-derived KIR2DL5/CD158f protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KIR2DL5/CD158f, present on NK cells, acts as a receptor for HLA-C alleles. Its inhibitory function finely tunes NK cell activity, preventing cell lysis by interacting with specific HLA-C molecules. This dynamic engagement contributes to the nuanced balance of inhibitory signals in the immune system, regulating NK cell responses to potential targets. KIR2DL5/CD158f Protein, Human (HEK293, Fc) is the recombinant human-derived KIR2DL5/CD158f protein, expressed by HEK293 , with C-hFc labeled tag.

Background

KIR2DL5/CD158f, expressed on natural killer (NK) cells, functions as a receptor for HLA-C alleles. This receptor operates in an inhibitory manner, regulating NK cell activity to prevent cell lysis. By interacting with specific HLA-C molecules, KIR2DL5 contributes to the delicate balance of inhibitory signals in the immune system, fine-tuning the response of NK cells to potential targets.

Biological Activity

Immobilized Human KIR2DL5 at 2 μg/mL (100 μL/well) can bind Anti- KIR2DL5 Antibody. The ED50 for this effect is 1.558 μg/mL.

  • Immobilized Human KIR2DL5 at 2 μg/mL (100 μL/well) can bind Anti- KIR2DL5 Antibody. The ED50 for this effect is 1.558 μg/mL.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q8N109/NP_065396.1 (H22-H240)

Gene ID

57292  [NCBI]

Molecular Construction
N-term
CD158f (H22-H240)
Accession # Q8N109/NP_065396.1
hFc
C-term
Synonyms
Killer cell immunoglobulin-like receptor 2DL5A; CD158f1; KIR2DL5A; CD158F
AA Sequence

HEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH

Molecular Weight

Approximately 65 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

KIR2DL5/CD158f Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KIR2DL5/CD158f Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77041
Quantity:
MCE Japan Authorized Agent: