Kallikrein-7 Protein, Human (HEK293, His)

Kallikrein-7 is a serine protease with chymotrypsin-like activity that plays a role in intercellular proteolysis, leading to epidermal exfoliation. It is involved in cancer invasion and metastasis, and elevated expression is associated with poor prognosis and cancer progression. Kallikrein-7 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-7 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of Kallikrein-7 Protein, Human (HEK293, His) is 231 a.a., with molecular weight of 30-33 KDa.

Kallikrein-7, a member of the kallikrein subfamily of serine proteases, exhibits chymotrypsin-like activity and participates in the proteolysis of intercellular cohesive structures preceding desquamation, the shedding of the outermost epidermal layer. This enzyme's diverse physiological functions extend to its involvement in cancer-related processes, including invasion and metastasis. Elevated expression of the Kallikrein-7 gene is associated with an unfavorable prognosis and the progression of various cancer types. Polymorphisms in this gene may contribute to the development of atopic dermatitis. Situated within a gene cluster on chromosome 19, this gene has multiple alternatively spliced transcript variants, reflecting its complexity and involvement in various cellular processes. With biased expression observed in skin (RPKM 68.1) and esophagus (RPKM 25.3), Kallikrein-7 emerges as a multifaceted protease with implications in both normal physiology and disease states.

Measured by its ability to cleave the fluorogenic peptide substrate Mca-RPKPVE-Nval-WRK (Dnp) NH2 and the specific activity is >150 pmoles/min/μg. (Activation description: The proenzyme needs to be activated by Thermolysin for an activated form)

Human

HEK293

C-10*His

NP_005037.1 (E23-R253)

5650  [NCBI]

EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR

30-33 kDa.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.