KMT2D Protein, Human

KMT2D Protein, a histone methyltransferase, methylates histone H3 'Lys-4' (H3K4), predominantly establishing H3K4me1 marks at active chromatin sites. Integral to chromatin remodeling, it functions as a coactivator for the estrogen receptor, recruited by ESR1, activating transcription. KMT2D's role in depositing specific histone marks at genomic locations underscores its crucial involvement in modulating chromatin structure and gene expression. KMT2D Protein, Human is the recombinant human-derived KMT2D protein, expressed by E. coli , with tag free.

KMT2D Protein, a histone methyltransferase, orchestrates the transfer of methyl groups from S-adenosyl-L-methionine to the epsilon-amino group of 'Lys-4' on histone H3 (H3K4). Integral to the chromatin remodeling machinery, it predominantly establishes H3K4me1 methylation marks at active chromatin sites associated with transcription and DNA repair processes. Functioning as a coactivator for the estrogen receptor, KMT2D is recruited by ESR1, thereby activating transcription. The enzyme's activity in depositing specific histone marks at functionally relevant genomic locations underscores its crucial role in modulating chromatin structure and gene expression.

Human

E. coli

Tag Free

O14686 (H5382-M5536)

8085

Partial

HSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGAWNCRKWM

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. /biology-dictionary/siha-cell.html