1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. KRAS Protein, Human (G12C, His)

KRAS Protein, Human (G12C, His)

Cat. No.: HY-P7804
COA Handling Instructions

KRAS Protein, Human (G12C, His) expresses in E. coli with a His tag at the N-terminus. KRAS G12C is an oncogenic driver mutation in multiple cancer types.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $78 In-stock
50 μg $220 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

KRAS Protein, Human (G12C, His) expresses in E. coli with a His tag at the N-terminus. KRAS G12C is an oncogenic driver mutation in multiple cancer types[1].

Background

KRAS is the most frequently mutated oncogene in tumors, with 20% of all solid tumors containing oncogenic KRAS mutations. One single type of KRAS mutation — called KRAS G12C — accounts for about 44% of all KRAS mutations. G12C is a single point mutation with a glycine-to-cysteine substitution at codon 12[1].

Biological Activity

Measured by its ability to catalyze the substrate GTP. The specific activity is 2.19 nmol/min/mg, as measured under the described conditions.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

AAH13572.1 (T2-C185, G12C)

Gene ID
Molecular Construction
N-term
6*His
KRAS (T2-C185, G12C)
Accession # AAH13572.1
C-term
Synonyms
Ki-Ras; c-K-ras; KRAS2; RASK2
AA Sequence

HHHHHHTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Molecular Weight

Approximately 26.0 kDa, observed by redu

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

KRAS Protein, Human (G12C, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KRAS Protein, Human (G12C, His)
Cat. No.:
HY-P7804
Quantity:
MCE Japan Authorized Agent: