Kras4B Protein, Human (184a.a, G12C, His)

Kras4B Protein, Human (184a.a, G12C, His) expresses in E. coli with a His tag at the N-terminus. KRAS G12C is an oncogenic driver mutation in multiple cancer types^[1].

KRAS is the most frequently mutated oncogene in tumors, with 20% of all solid tumors containing oncogenic KRAS mutations. One single type of KRAS mutation — called KRAS G12C — accounts for about 44% of all KRAS mutations. G12C is a single point mutation with a glycine-to-cysteine substitution at codon 12^[1].

1.Measured by its ability to catalyze the substrate GTP. The specific activity is 2.19 nmol/min/mg, as measured under the described conditions.
2.Measured by its ability to catalyze 6.67 mM substrate GTP(HY-W010737). Which can be measured by absorbance at 620 nm that incubate at room temperature for 30 minutes. The specific activity is ≥8.30 U/L. 1 unit of activity is the amount of enzyme that catalyzes the production of 1 µmole of free phosphate per minute under the assay conditions.

Human

E. coli

N-6*His

AAH13572.1 (T2-C185, G12C)

3845  [NCBI]

Partial

TEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Approximately 23-26.0 kDa, observed by reducing SDS-PAGE.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Naiara Santana-Codina, et al. Defining and Targeting Adaptations to Oncogenic KRAS G12C Inhibition Using Quantitative Temporal Proteomics. Cell Rep. 2020 Mar 31;30(13):4584-4599.e4.  [Content Brief]