Kras4B Protein, Human (184a.a, G12C, His)
Based on 1 Customer Validation
Kras4B Protein, Human (184a.a, G12C, His) expresses in E. coli with a His tag at the N-terminus. KRAS G12C is an oncogenic driver mutation in multiple cancer types.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Kras4B Protein, Human (184a.a, G12C, His) expresses in E. coli with a His tag at the N-terminus. KRAS G12C is an oncogenic driver mutation in multiple cancer types[1].
Background
KRAS is the most frequently mutated oncogene in tumors, with 20% of all solid tumors containing oncogenic KRAS mutations. One single type of KRAS mutation — called KRAS G12C — accounts for about 44% of all KRAS mutations. G12C is a single point mutation with a glycine-to-cysteine substitution at codon 12[1].
Verified Bioactivity
1.Measured by its ability to catalyze the substrate GTP. The specific activity is 2.19 nmol/min/mg, as measured under the described conditions.
2.Measured by its ability to catalyze 6.67 mM substrate GTP(HY-W010737). Which can be measured by absorbance at 620 nm that incubate at room temperature for 30 minutes. The specific activity is ≥8.30 U/L. 1 unit of activity is the amount of enzyme that catalyzes the production of 1 µmole of free phosphate per minute under the assay conditions.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
AAH13572.1 (T2-C185, G12C)
-
Molecular Construction
-
N-term
-
6*His
-
KRAS (T2-C185, G12C)
Accession # AAH13572.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
KRAS; Kras-Enoph1 Fusion Protein; Prev. KRAS2; PR310 C-K-Ras Oncogene; GTPase KRas; Small Monomeric GTPase; K-Ras4B; C-Kirsten-Ras Protein; KRAS1; Proto-Oncogene GTPase; V-Ki-Ras2 Kirsten Rat Sarcoma 2 Viral Oncogene Homolog; KRAS-ENOPH Fusion; Kirsten Ra
-
AA Sequence
TEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
-
Molecular Weight
Approximately 23-26 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
