1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. LDHA Protein, Mouse (HEK293, His)

LDHA Protein, Mouse (HEK293, His)

Cat. No.: HY-P70259
COA Handling Instructions

LDHA protein catalyzes the simultaneous and stereospecific interconversion of pyruvate and lactate, accompanied by the reciprocal interconversion of NADH and NAD(+). LDHA Protein, Mouse (HEK293, His) is the recombinant mouse-derived LDHA protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LDHA Protein, Mouse (HEK293, His) is 332 a.a., with molecular weight of ~35.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $160 In-stock
50 μg $450 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LDHA protein catalyzes the simultaneous and stereospecific interconversion of pyruvate and lactate, accompanied by the reciprocal interconversion of NADH and NAD(+). LDHA Protein, Mouse (HEK293, His) is the recombinant mouse-derived LDHA protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LDHA Protein, Mouse (HEK293, His) is 332 a.a., with molecular weight of ~35.0 kDa.

Background

LDHA Protein, an isoform of lactate dehydrogenase, plays a critical role in cellular metabolism. It catalyzes the conversion of pyruvate to lactate, generating energy under anaerobic conditions. Understanding the functions of LDHA Protein is essential for studying metabolic disorders and developing therapeutic strategies targeting altered metabolism in cancer and other diseases.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P06151 (M1-F332)

Gene ID

16828  [NCBI]

Molecular Construction
N-term
LDHA (M1-F332)
Accession # P06151
6*His
C-term
Synonyms
rMuL-lactate dehydrogenase, His; LDHA; Ldh1; L-lactate dehydrogenase
AA Sequence

MATLKDQLIVNLLKEEQAPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLKTPKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGINEDVFLSVPCILGQNGISDVVKVTLTPEEEARLKKSADTLWGIQKELQF

Molecular Weight

Approximately 35.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 50%Glycerol, 500 mM NaCl, 5% Trehalose, 5% Mannitol, 0.01% Tween80, 1 mM EDTA, pH 9.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

LDHA Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LDHA Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70259
Quantity:
MCE Japan Authorized Agent: