LAG-3 Protein, Cynomolgus (HEK293, His)

LAG-3 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived LAG-3 protein, expressed by HEK293, with C-His tag.

LAG-3 (Lymphocyte activation gene 3) protein is an inhibitory receptor expressed on antigen-activated T-cells, delivering inhibitory signals upon binding to ligands such as FGL1. Serving as a major ligand of LAG3, FGL1 is responsible for LAG3's T-cell inhibitory function. Following T-cell receptor (TCR) engagement, LAG3 associates with CD3-TCR in the immunological synapse, directly inhibiting T-cell activation. LAG3 may synergistically inhibit antigen-specific T-cell activation with PDCD1/PD-1, possibly acting as a coreceptor for PD-1. It negatively regulates the proliferation, activation, effector function, and homeostasis of both CD8(+) and CD4(+) T-cells. Constitutively expressed on a subset of regulatory T-cells (Tregs), LAG3 contributes to their suppressive function, mediating immune tolerance. Additionally, LAG3 acts as a negative regulator of plasmacytoid dendritic cell (pDCs) activation and binds to MHC class II (MHC-II), possibly functioning as a ligand for MHC-II on antigen-presenting cells, thereby promoting APC activation/maturation and driving Th1 immune responses.

Cynomolgus

HEK293

C-His

XP_005570011.1 (A18-H449)

102122272

Partial

APVKPPQPGAEISVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAXAPGHPPVPGHRPAAPYSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRATVHLRDRALSCRLRLRVGQASMTASPPGSLRTSDWVILNCSFSRPDRPASVHWFRSRGQGRVPVQGSPHHHLAESFLFLPHVGPMDSGLWGCILTYRDGFNVSIMYNLTVLGLEPATPLTVYAGAGSRVELPCRLPPAVGTQSFLTAKWAPPGGGPDLLVAGDNGDFTLRLEDVSQAQAGTYICHIRLQGQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPASGQEHFVWSPLNTPSQRSFSGPWLEAQEAQLLSQPWQCQLHQGERLLGAAVYFTELSSPGAQRSGRAPGALRAGH

Approximately 45-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.