LAG-3 Protein, Cynomolgus (P74, HEK293, His)

LAG-3 Protein, expressed on antigen-activated T-cells, delivers inhibitory signals by binding to ligands like FGL1. LAG-3 Protein associates with CD3-TCR, directly inhibiting T-cell activation^[1][2]. LAG-3 Protein, Cynomolgus (P74, HEK293, His) is a recombinant protein dimer complex containing cynomolgus-derived LAG-3 protein, expressed by HEK293 , with N-8*His labeled tag.

LAG-3 Protein serves as an inhibitory receptor for antigen-activated T cells and transmits inhibitory signals after binding to ligands such as FGL1, which is a major contributor to the inhibitory function of LAG3 T cells^[1][2]. Upon T cell receptor (TCR) engagement, LAG-3 Protein binds to CD3-TCR in the immune synapse and directly blocks T cell activation. LAG-3 Protein may cooperate with PDCD1/PD-1, potentially acting as a coreceptor for PD-1 and inhibiting antigen-specific T cell activation^[3]. This protein negatively regulates the proliferation, activation, effector function, and homeostasis of CD8(+) and CD4(+) T cells. Furthermore, LAG-3 Protein plays a key role in immune tolerance and is constitutively expressed on a subset of regulatory T cells (Tregs), contributing to their suppressive function^[4]. LAG-3 Protein acts as a negative regulator of plasmacytoid dendritic cell (pDC) activation and exhibits interaction with MHC class II (MHC-II), although the exact role of MHC-II binding remains unclear. LAG-3 may function as a ligand for MHC class II on antigen-presenting cells (APCs), potentially promoting APC activation/maturation and driving Th1 immune responses.

Cynomolgus

HEK293

N-8*His

XP_005570011.1 (P23-L450, P74)

102122272  [NCBI]

Partial

PQPGAEISVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAPAPGHPPVPGHRPAAPYSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRATVHLRDRALSCRLRLRVGQASMTASPPGSLRTSDWVILNCSFSRPDRPASVHWFRSRGQGRVPVQGSPHHHLAESFLFLPHVGPMDSGLWGCILTYRDGFNVSIMYNLTVLGLEPATPLTVYAGAGSRVELPCRLPPAVGTQSFLTAKWAPPGGGPDLLVAGDNGDFTLRLEDVSQAQAGTYICHIRLQGQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPASGQEHFVWSPLNTPSQRSFSGPWLEAQEAQLLSQPWQCQLHQGERLLGAAVYFTELSSPGAQRSGRAPGALRAGHL

Approximately 55-65 kDa &140 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.