LAG-3 Protein, Rat (HEK293, His)
LAG-3 (lymphocyte activation gene 3) protein is an inhibitory receptor on antigen-activated T cells, which transmits inhibitory signals by binding to ligands such as FGL1. LAG-3 is associated with CD3-TCR at the immune synapse, hinders T cell activation, and may cooperate with PDCD1/PD-1 to act as a co-receptor for PD-1. LAG-3 Protein, Rat (HEK293, His) is the recombinant rat-derived LAG-3 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
LAG-3 (lymphocyte activation gene 3) protein is an inhibitory receptor on antigen-activated T cells, which transmits inhibitory signals by binding to ligands such as FGL1. LAG-3 is associated with CD3-TCR at the immune synapse, hinders T cell activation, and may cooperate with PDCD1/PD-1 to act as a co-receptor for PD-1. LAG-3 Protein, Rat (HEK293, His) is the recombinant rat-derived LAG-3 protein, expressed by HEK293 , with C-His labeled tag.
Background
LAG-3 (Lymphocyte activation gene 3) protein serves as an inhibitory receptor on antigen-activated T-cells, delivering inhibitory signals upon binding to ligands such as FGL1, a major contributor to LAG3's T-cell inhibitory function. Upon T-cell receptor (TCR) engagement, LAG3 associates with CD3-TCR in the immunological synapse, directly impeding T-cell activation. LAG3 may collaborate with PDCD1/PD-1, potentially acting as a coreceptor for PD-1, to inhibit antigen-specific T-cell activation. This protein negatively regulates the proliferation, activation, effector function, and homeostasis of both CD8(+) and CD4(+) T-cells. Furthermore, LAG-3 plays a pivotal role in immune tolerance, being constitutively expressed on a subset of regulatory T-cells (Tregs), contributing to their suppressive function. Additionally, LAG-3 acts as a negative regulator of plasmacytoid dendritic cell (pDCs) activation and exhibits interactions with MHC class II (MHC-II), although the precise role of MHC-II binding remains unclear. LAG-3 may function as a ligand for MHC class II on antigen-presenting cells (APC), potentially promoting APC activation/maturation and driving Th1 immune responses.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-10*His
-
Accession
Q5BK54 (G24-L442)
-
Molecular Construction
-
N-term
-
LAG-3 (G24-L442)
Accession # Q5BK54 -
10*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
LAG3; Lymphocyte-Activation Gene 3; Lymphocyte Activating 3; CD223 Antigen; CD223; LAG-3; Lymphocyte Activation Gene 3 Protein; FDC
-
AA Sequence
GPGKELSVVWAQEGAPVHLPCSLEFPHLDPNFLRRGWVTWQHRPDSDQPASIPALDLLQGMPSTRRHPPHRYTVLSVAPGGLRSGRQPLLSHVQLEKRGPQRGDFSLWLRPATRKDAGEYHAFVRLPDRDFSCSLRLRVGQASMIASPPGTLKPSDWVILNCSFSRPDRPVSVHWFQGQSRVPVHNSPRHYLAESFLLLPQVSPLDSGTWGCVLTYRDGFNVSITYNLKVQGLEPVAPLTVYAAEGSRVELPCHLPPVVGTPSLLIAKWTPPGGGPELPVTGKSGNFTLQLENVGRAQAGTYTCSIHLQGRQLSAAVTLAVITVTPKSFGLPGSPQKLLCEVVPASGEGRFVWRPLSDLSRSSLGPVLELQEAKLLAEQWQCQLYEGQKLLGATVYTAESSSGAWSAKRISGDLKGGHL
-
Predicted Molecular Mass
47.1 kDa
-
Molecular Weight
Approximately 55-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)