LAG-3 Protein, Human (HEK293, mFc)
LAG-3 (lymphocyte activating gene 3) protein is an inhibitory receptor on antigen-activated T cells and is critical for immune regulation. LAG-3 binds to FGL1 and transmits inhibitory signals that negatively affect CD8(+) and CD4(+) T cell proliferation, activation, and effector functions. LAG-3 Protein, Human (HEK293, mFc) is the recombinant human-derived LAG-3 protein, expressed by HEK293 , with C-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
LAG-3 (lymphocyte activating gene 3) protein is an inhibitory receptor on antigen-activated T cells and is critical for immune regulation. LAG-3 binds to FGL1 and transmits inhibitory signals that negatively affect CD8(+) and CD4(+) T cell proliferation, activation, and effector functions. LAG-3 Protein, Human (HEK293, mFc) is the recombinant human-derived LAG-3 protein, expressed by HEK293 , with C-mFc labeled tag.
Background
LAG-3 (Lymphocyte activation gene 3) protein, an inhibitory receptor present on antigen-activated T-cells, plays a crucial role in immune regulation. Upon binding to its major ligand, FGL1, LAG-3 delivers inhibitory signals that negatively regulate the proliferation, activation, effector function, and homeostasis of both CD8(+) and CD4(+) T-cells. Acting in synergy with PDCD1/PD-1, LAG-3 may inhibit antigen-specific T-cell activation, particularly following T-cell receptor (TCR) engagement where it associates with CD3-TCR in the immunological synapse. Beyond its role in T-cell inhibition, LAG-3 is constitutively expressed on a subset of regulatory T-cells (Tregs), contributing to their suppressive function and mediating immune tolerance. Additionally, LAG-3 negatively regulates plasmacytoid dendritic cell (pDCs) activation and, intriguingly, interacts with MHC class II (MHC-II), potentially acting as both a ligand for MHC-II on antigen-presenting cells (APC) and a promoter of APC activation/maturation, thereby influencing Th1 immune response.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
P18627-1 (L23-L450)
-
Molecular Construction
-
N-term
-
LAG-3 (L23-L450)
Accession # P18627-1 -
mFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
LAG3; Lymphocyte-Activation Gene 3; Lymphocyte Activating 3; CD223 Antigen; CD223; LAG-3; Lymphocyte Activation Gene 3 Protein; FDC
-
AA Sequence
LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL
-
Predicted Molecular Mass
72.7 kDa
-
Molecular Weight
Approximately 90 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)