LAG-3 Protein, Human (HEK293, mFc)

LAG-3 (lymphocyte activating gene 3) protein is an inhibitory receptor on antigen-activated T cells and is critical for immune regulation. LAG-3 binds to FGL1 and transmits inhibitory signals that negatively affect CD8(+) and CD4(+) T cell proliferation, activation, and effector functions. LAG-3 Protein, Human (HEK293, mFc) is the recombinant human-derived LAG-3 protein, expressed by HEK293 , with C-mFc labeled tag.

LAG-3 (Lymphocyte activation gene 3) protein, an inhibitory receptor present on antigen-activated T-cells, plays a crucial role in immune regulation. Upon binding to its major ligand, FGL1, LAG-3 delivers inhibitory signals that negatively regulate the proliferation, activation, effector function, and homeostasis of both CD8(+) and CD4(+) T-cells. Acting in synergy with PDCD1/PD-1, LAG-3 may inhibit antigen-specific T-cell activation, particularly following T-cell receptor (TCR) engagement where it associates with CD3-TCR in the immunological synapse. Beyond its role in T-cell inhibition, LAG-3 is constitutively expressed on a subset of regulatory T-cells (Tregs), contributing to their suppressive function and mediating immune tolerance. Additionally, LAG-3 negatively regulates plasmacytoid dendritic cell (pDCs) activation and, intriguingly, interacts with MHC class II (MHC-II), potentially acting as both a ligand for MHC-II on antigen-presenting cells (APC) and a promoter of APC activation/maturation, thereby influencing Th1 immune response.

Human

HEK293

C-mFc

P18627-1 (L23-L450)

3902  [NCBI]

Extracellular Domain

LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL

Approximately 90 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.