LALBA Protein, Human (HEK293, His)

LALBA proteins are regulatory subunits of lactose synthase and play a key role in altering the substrate specificity of mammary galactosyltransferase. This modification allows galactosyltransferase to utilize glucose, promoting the synthesis of lactose - the main milk carbohydrate. LALBA Protein, Human (HEK293, His) is the recombinant human-derived LALBA protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LALBA Protein, Human (HEK293, His) is 123 a.a., with molecular weight of 14 kDa.

LALBA protein serves as the regulatory subunit of lactose synthase, exerting a pivotal role in altering the substrate specificity of galactosyltransferase within the mammary gland. This modification enables galactosyltransferase to utilize glucose as a proficient acceptor substrate, facilitating the synthesis of lactose—the predominant carbohydrate constituent of milk. Beyond its involvement in lactose synthesis, in various tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of oligosaccharide chains in glycoproteins. Functioning as part of lactose synthase (LS), LALBA collaborates with the catalytic component, beta1,4-galactosyltransferase (beta4Gal-T1), to form a heterodimeric complex that orchestrates the intricate processes of lactose production, contributing to the essential composition of milk.

Human

HEK293

C-6*His

P00709 (K20-L142)

3906  [NCBI]

KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

14 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.