Langerin/CD207 Protein, Rhesus Macaque (HEK293, Fc)

Langerin, also known as CD207, is a calcium-dependent lectin with mannose-binding specificity. Notably, it induces the formation of Birbeck granules (BG) and acts as an effective regulator of membrane stacking and zipping. Langerin/CD207 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived Langerin/CD207 protein, expressed by HEK293 , with N-hFc labeled tag.

Langerin, also known as CD207, is a calcium-dependent lectin with a specific affinity for mannose. This protein plays a crucial role in antigen uptake and processing. Langerin induces the formation of Birbeck granules (BGs) and acts as a potent regulator of membrane superimposition and zippering. It demonstrates binding capabilities not only to mannosylated glycans but also to sulfated glycans such as keratan sulfate (KS) and beta-glucans. As a homotrimer, Langerin facilitates the uptake of antigens and is involved in the routing and processing of antigens for presentation to T cells. The multifaceted functions of Langerin highlight its significance in immune response modulation and antigen presentation pathways.

Measured by its binding ability in a functional ELISA. Immobilized Rhesus Macaque CD207, at 2 μg/mL (100 μL/well) can bind Anti-CD207 antibody. The ED₅₀ for this effect is 94.98 ng/mL.

Rhesus Macaque

HEK293

N-hFc

EHH22200.1 (P65-P328)

/

PRFMGNISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQTVNVSLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVGTLNAQIPELKSDLEKASALNTKIRALQGSLDNMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLVTKTWYSAQQFCVSRNSHLTSVTSESEQEFLYKTAGGLTYWIGLTKAGMEGDWFWVDDTPFDKVQSAKFWIPGEPNNAGNNEHCGNIRVSSLQAWNDAQCDKTFLFICKRPYIPSEP

Approximately 65-80 kDa due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.