LDHA Protein, Rat (His)

Customer Review

Based on 1 Customer Validation

The LDHA protein facilitates the simultaneous and stereospecific interconversion of pyruvate and lactate, accompanied by the concomitant exchange of NADH and NAD(+).LDHA Protein, Rat (His) is the recombinant rat-derived LDHA protein, expressed by E.coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The LDHA protein facilitates the simultaneous and stereospecific interconversion of pyruvate and lactate, accompanied by the concomitant exchange of NADH and NAD(+).LDHA Protein, Rat (His) is the recombinant rat-derived LDHA protein, expressed by E.coli , with N-His labeled tag.

Background

LDHA Protein, an isoform of lactate dehydrogenase, is vital in cellular metabolism, converting pyruvate to lactate for energy production in anaerobic conditions. Understanding LDHA Protein's functions is crucial for studying metabolic disorders and developing therapies targeting altered metabolism in cancer and other diseases.

Verified Bioactivity

Measured by its ability to reduce pyruvate to lactate. The specific activity is 70337.62058 pmol/min/μg, as measured under the described conditions.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • LDHA (M1-F332)
      Accession # P04642
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    LDHA; Epididymis Secretory Sperm Binding Protein Li 133P; Lactate Dehydrogenase A; Proliferation-Inducing Gene 19; L-Lactate Dehydrogenase A Chain; Lactate Dehydrogenase M; LDH Muscle Subunit; L-Lactate Dehydrogenase; Cell Proliferation-Inducing Gene 19 P

  • AA Sequence

    MAALKDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPDEEARLKKSADTLWGIQKELQF

  • Molecular Weight

    Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00