Leptin Protein, Mouse (His)

Leptin is a key regulator of energy balance and body weight and binds to LEPR receptors in multiple tissues. It controls appetite in the hypothalamus and affects bone mass, hormone regulation, and reproductive function. Leptin Protein, Mouse (His) is the recombinant mouse-derived Leptin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Leptin Protein, Mouse (His) is 146 a.a., with molecular weight of ~17 kDa.

Leptin, a key regulator in the orchestration of energy balance and body weight, exerts comprehensive effects once released into circulation by binding to its receptor, LEPR, present in diverse tissues. In the hypothalamus, it acts as an appetite-regulating factor, inducing a decrease in food intake and an increase in energy consumption through the modulation of anorexinogenic and orexigenic neuropeptides. Leptin further extends its influence beyond appetite control, regulating bone mass, hypothalamo-pituitary-adrenal hormones, and impacting reproductive function. In peripheral tissues, it enhances basal metabolism, influences pancreatic beta-cell function, and exhibits pro-angiogenic properties. Within the arcuate nucleus of the hypothalamus, leptin activates POMC neurons and inhibits NPY neurons, orchestrating the release of anorexigenic and orexigenic peptides, respectively. Additionally, leptin plays a modulatory role in nutrient absorption, reducing glucose uptake in the intestine. It functions as a growth factor, activating various signaling pathways to regulate gene expression involved in cell cycle control, apoptosis, and angiogenesis. In innate immunity, leptin modulates neutrophil activity, enhances macrophage function, and promotes a pro-inflammatory response. In adaptive immunity, it influences T-cell responses, promoting T helper-1 cell immune responses and regulating CD4(+)CD25(-) T-cell proliferation through MTOR signaling pathway activation.

Fully biologically active determined by the dose dependent proliferation of MCF-7 cells. The ED₅₀ for this effect is 1.680 ng/mL, corresponding to a specific activity is 5.95×10⁵ units/mg.

• 
  Fully biologically active determined by the dose dependent proliferation of MCF-7 cells. The ED₅₀ for this effect is 1.680 ng/mL, corresponding to a specific activity is 5.95×10⁵ units/mg.

Mouse

E. coli

N-6*His

Q544U0 (V22-C167)

16846  [NCBI]

VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC

Approximately 17 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.