LIF Protein, Mouse (HEK293)

Customer Review

Based on 1 Customer Validation

LIF (Leukemia Inhibitory Factor) prompts terminal differentiation in leukemic cells, inducing hematopoietic and neuronal cell differentiation. It also stimulates acute-phase protein synthesis in hepatocytes. LIF's multifaceted role underscores its significance in regulating hematopoiesis, neurogenesis, and hepatic responses. LIF Protein, Mouse (HEK293) is the recombinant mouse-derived LIF protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

LIF (Leukemia Inhibitory Factor) prompts terminal differentiation in leukemic cells, inducing hematopoietic and neuronal cell differentiation. It also stimulates acute-phase protein synthesis in hepatocytes. LIF's multifaceted role underscores its significance in regulating hematopoiesis, neurogenesis, and hepatic responses. LIF Protein, Mouse (HEK293) is the recombinant mouse-derived LIF protein, expressed by HEK293 , with tag free.

Background

LIF (Leukemia Inhibitory Factor) exhibits the capability to prompt terminal differentiation in leukemic cells, showcasing a diverse range of activities. Notably, it induces hematopoietic differentiation in both normal and myeloid leukemia cells, facilitates neuronal cell differentiation, and stimulates the synthesis of acute-phase proteins in hepatocytes. This multifaceted role underscores LIF's significance in orchestrating various cellular processes, contributing to the regulation of hematopoiesis, neurogenesis, and hepatic responses.

Verified Bioactivity

1. Measured by its ability to inhibit the proliferation of M1 mouse myeloid leukemia cells.The ED50 for this effect is typically 0.1-0.5 ng/mL.
2. Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 this effect is 50-100 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 this effect is 69.78 ng/mL, corresponding to a specific activity is 1.4331×104 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • LIF (S24-F203)
      Accession # P09056/NP_032527.1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    LIF; Hepatocyte-Stimulating Factor III; LIF Interleukin 6 Family Cytokine; Differentiation-Inducing Factor; HILDA; Melanoma-Derived LPL Inhibitor; Leukemia Inhibitory Factor; Human Interleukin In DA Cells; CDF; D Factor; DIA; MLPLI; Differentiation Inhibi

  • AA Sequence

    SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

  • Predicted Molecular Mass

    19.9 kDa

  • Molecular Weight

    Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00