1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Leukemia Inhibitory Factor
  5. LIF Protein, Mouse (HEK293)

LIF (Leukemia Inhibitory Factor) prompts terminal differentiation in leukemic cells, inducing hematopoietic and neuronal cell differentiation. It also stimulates acute-phase protein synthesis in hepatocytes. LIF's multifaceted role underscores its significance in regulating hematopoiesis, neurogenesis, and hepatic responses. LIF Protein, Mouse (HEK293) is the recombinant mouse-derived LIF protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LIF (Leukemia Inhibitory Factor) prompts terminal differentiation in leukemic cells, inducing hematopoietic and neuronal cell differentiation. It also stimulates acute-phase protein synthesis in hepatocytes. LIF's multifaceted role underscores its significance in regulating hematopoiesis, neurogenesis, and hepatic responses. LIF Protein, Mouse (HEK293) is the recombinant mouse-derived LIF protein, expressed by HEK293 , with tag free.

Background

LIF (Leukemia Inhibitory Factor) exhibits the capability to prompt terminal differentiation in leukemic cells, showcasing a diverse range of activities. Notably, it induces hematopoietic differentiation in both normal and myeloid leukemia cells, facilitates neuronal cell differentiation, and stimulates the synthesis of acute-phase proteins in hepatocytes. This multifaceted role underscores LIF's significance in orchestrating various cellular processes, contributing to the regulation of hematopoiesis, neurogenesis, and hepatic responses.

Biological Activity

1. Measured by its ability to inhibit the proliferation of M1 mouse myeloid leukemia cells.The ED50 for this effect is typically 0.1-0.5 ng/mL.
2. Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 this effect is 50-100 ng/mL.

  • Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 this effect is 69.78 ng/mL, corresponding to a specific activity is 1.4331×104 units/mg.
Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

P09056/NP_032527.1 (S24-F203)

Gene ID
Molecular Construction
N-term
LIF (S24-F203)
Accession # P09056/NP_032527.1
C-term
Protein Length

Full Length of Mature Protein

Synonyms
LIF; Leukemia inhibitory factor; HILDA; D factor; MLPLI
AA Sequence

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

Predicted Molecular Mass
19.9 kDa
Molecular Weight

Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LIF Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LIF Protein, Mouse (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LIF Protein, Mouse (HEK293)
Cat. No.:
HY-P73279
Quantity:
MCE Japan Authorized Agent: