1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Leukemia Inhibitory Factor
  5. LIF Protein, Mouse (HEK293)

LIF Protein, Mouse (HEK293)

Cat. No.: HY-P73279
COA Handling Instructions

LIF (Leukemia Inhibitory Factor) prompts terminal differentiation in leukemic cells, inducing hematopoietic and neuronal cell differentiation. It also stimulates acute-phase protein synthesis in hepatocytes. LIF's multifaceted role underscores its significance in regulating hematopoiesis, neurogenesis, and hepatic responses. LIF Protein, Mouse (HEK293) is the recombinant mouse-derived LIF protein, expressed by HEK293 , with tag free. The total length of LIF Protein, Mouse (HEK293) is 180 a.a., with molecular weight of ~35.6 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg $35 In-stock
10 μg $100 In-stock
50 μg $285 In-stock
100 μg $480 In-stock
500 μg $1350 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LIF (Leukemia Inhibitory Factor) prompts terminal differentiation in leukemic cells, inducing hematopoietic and neuronal cell differentiation. It also stimulates acute-phase protein synthesis in hepatocytes. LIF's multifaceted role underscores its significance in regulating hematopoiesis, neurogenesis, and hepatic responses. LIF Protein, Mouse (HEK293) is the recombinant mouse-derived LIF protein, expressed by HEK293 , with tag free. The total length of LIF Protein, Mouse (HEK293) is 180 a.a., with molecular weight of ~35.6 kDa.

Background

LIF (Leukemia Inhibitory Factor) exhibits the capability to prompt terminal differentiation in leukemic cells, showcasing a diverse range of activities. Notably, it induces hematopoietic differentiation in both normal and myeloid leukemia cells, facilitates neuronal cell differentiation, and stimulates the synthesis of acute-phase proteins in hepatocytes. This multifaceted role underscores LIF's significance in orchestrating various cellular processes, contributing to the regulation of hematopoiesis, neurogenesis, and hepatic responses.

Biological Activity

1. Measured by its ability to inhibit the proliferation of M1 mouse myeloid leukemia cells.The ED50 for this effect is typically 0.1-0.5 ng/mL.
2. Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 this effect is 69.78 ng/mL, corresponding to a specific activity is 1.4331×104 units/mg.

  • Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 this effect is 69.78 ng/mL, corresponding to a specific activity is 1.4331×104 units/mg.
Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

P09056/NP_032527.1 (S24-F203)

Gene ID

16878  [NCBI]

Molecular Construction
N-term
LIF (S24-F203)
Accession # P09056
C-term
Synonyms
LIF; Leukemia inhibitory factor; HILDA; D factor; MLPLI
AA Sequence

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

Molecular Weight

Approximately 35.6 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LIF Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LIF Protein, Mouse (HEK293)
Cat. No.:
HY-P73279
Quantity:
MCE Japan Authorized Agent: