LILRA1/LIR-6/CD85i Protein, Human (Biotinylated, HEK293, His-Avi)

LILRA1/LIR-6/CD85i protein serves as a receptor for class I MHC antigens and plays a crucial role in immune recognition and response. Its interaction with class I MHC molecules suggests involvement in monitoring and possibly influencing immune activity. LILRA1/LIR-6/CD85i Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LILRA1/LIR-6/CD85i protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

LILRA1/LIR-6/CD85i Protein appears to serve as a receptor for class I MHC antigens, indicating a crucial role in immune recognition and response. Its interaction with class I MHC molecules suggests involvement in monitoring and potentially influencing immune activities. Operating as a receptor, LILRA1 may contribute to the fine-tuned recognition of cells presenting class I MHC antigens, thereby playing a key role in immune surveillance. Further investigation into LILRA1's interactions and its impact on immune signaling could deepen our understanding of its function as a receptor and its potential implications in immune surveillance and regulatory processes.

Human

HEK293

C-Avi;C-8*His

O75019-1 (P17-N461)

11024  [NCBI]

Extracellular Domain

Biotin

PRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVEN

Approximately 70-80 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.