LILRB2/CD85d/ILT-4 Protein, Human (Biotinylated, HEK293, Fc-Avi)

The LILRB2/CD85d/ILT-4 protein is a receptor for class I MHC antigens and can recognize multiple HLA alleles. It crucially downregulates the immune response and builds tolerance. LILRB2/CD85d/ILT-4 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived LILRB2/CD85d/ILT-4 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of LILRB2/CD85d/ILT-4 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 440 a.a., with molecular weight of 90-110 kDa.

The LILRB2/CD85d/ILT-4 Protein serves as a receptor for class I MHC antigens, demonstrating recognition across a broad spectrum of HLA-A, HLA-B, HLA-C, HLA-G, and HLA-F alleles. It plays a crucial role in immune response down-regulation and the establishment of tolerance. Specifically, it recognizes HLA-G in complex with B2M/beta-2 microglobulin and a nonamer self-peptide, leading to the differentiation of type 1 regulatory T cells and myeloid-derived suppressor cells, crucial for maintaining maternal-fetal tolerance. LILRB2 competes with CD8A for binding to class I MHC antigens and inhibits FCGR1A-mediated cellular responses, including phosphorylation of proteins and mobilization of intracellular calcium ions. Moreover, it interacts with PTPN6 when phosphorylated and binds to FCGR1A. The direct interactions with peptide-bound HLA-G-B2M and HLA-F-B2M further highlight its involvement in immune modulation.

Human

HEK293

C-Avi;C-hFc

AAH36827 (Q22-V461)

10288  [NCBI]

Biotin

QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHLGV

90-110 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of Tris with Glycine, Arginine and NaCl, pH 7.5. Normally trehalose is added as protectant before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.