1. Recombinant Proteins
  2. Others
  3. Lipocalin-2/NGAL Protein, Mouse (HEK293, Fc)

Lipocalin-2/NGAL, an iron-trafficking protein, interacts with 2,3-DHBA and modulates cellular iron levels.It acts as a conveyor or extractor of iron, depending on the cellular context.Lipocalin-2/NGAL can increase intracellular iron concentration or reduce it, affecting apoptosis and innate immunity.It can also bind siderophores from M.tuberculosis and exist as a monomer, homodimer, or heterodimer with MMP9.Lipocalin-2/NGAL Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Lipocalin-2/NGAL protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Lipocalin-2/NGAL, an iron-trafficking protein, interacts with 2,3-DHBA and modulates cellular iron levels.It acts as a conveyor or extractor of iron, depending on the cellular context.Lipocalin-2/NGAL can increase intracellular iron concentration or reduce it, affecting apoptosis and innate immunity.It can also bind siderophores from M.tuberculosis and exist as a monomer, homodimer, or heterodimer with MMP9.Lipocalin-2/NGAL Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Lipocalin-2/NGAL protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Lipocalin-2/NGAL, an iron-trafficking protein, participates in various biological processes, including apoptosis, innate immunity, and renal development. Through its interaction with the siderophore 2,3-dihydroxybenzoic acid (2,3-DHBA), reminiscent of bacterial enterobactin, Lipocalin-2/NGAL modulates cellular iron levels, acting as a conveyor or extractor of iron depending on the cellular context. The iron-bound form (holo-24p3) is internalized upon binding to the SLC22A17 (24p3R) receptor, releasing iron and elevating intracellular iron concentration. Conversely, the iron-free form (apo-24p3), upon binding to SLC22A17 (24p3R), associates with an intracellular siderophore, leading to iron chelation and subsequent extracellular iron transfer, thereby diminishing intracellular iron levels. In the realm of apoptosis induced by interleukin-3 (IL3) deprivation, the iron-loaded form averts apoptosis by increasing intracellular iron concentration, while the iron-free form fosters apoptosis by reducing intracellular iron levels, inducing the expression of the proapoptotic protein BCL2L11/BIM. Lipocalin-2/NGAL also plays a crucial role in innate immunity by restraining bacterial proliferation through the sequestration of iron bound to microbial siderophores like enterobactin. Moreover, it exhibits the ability to bind siderophores from M.tuberculosis. Lipocalin-2/NGAL can exist as a monomer, a homodimer linked by disulfide bonds, or a heterodimer with MMP9, further expanding its functional versatility.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

P11672 (Q21-N200)

Gene ID
Molecular Construction
N-term
NGAL (Q21-N200)
Accession # P11672
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
NGAL; Lipocalin-2; Oncogene 24p3; p25; Siderocalin LCN2; MSFI
AA Sequence

QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN

Molecular Weight

50-60 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, 10% glycerol, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Lipocalin-2/NGAL Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Lipocalin-2/NGAL Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Lipocalin-2/NGAL Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P78329
Quantity:
MCE Japan Authorized Agent: