Lithostathine-1/Reg1 Protein, Mouse (His-SUMO)
Based on 1 Customer Validation
Lithostathine-1/Reg1 Protein potentially inhibits spontaneous calcium carbonate precipitation.Lithostathine-1/Reg1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Lithostathine-1/Reg1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Lithostathine-1/Reg1 Protein potentially inhibits spontaneous calcium carbonate precipitation.Lithostathine-1/Reg1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Lithostathine-1/Reg1 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.
Background
Lithostathine-1/Reg1 protein may function as an inhibitor of spontaneous calcium carbonate precipitation.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
P43137 (Q22-G165)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
Reg1 (Q22-G165)
Accession # P43137 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ZC3H12A; MCPIP-1; Zinc Finger CCCH-Type Containing 12A; MCPIP; Regnase-1; Reg1; MCPIP1; Bifunctional Endoribonuclease And Deubiquitinase ZC3H12A; Monocyte Chemotactic Protein-Induced Protein 1; MCP-1 Treatment-Induced Protein; Zinc Finger CCCH Domain-Cont
-
AA Sequence
QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG
-
Predicted Molecular Mass
32.2 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (233 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
