LMAN2L Protein, Human (HEK293, His)
The LMAN2L protein plays a critical role in cellular processes and may regulate the export of a specific subset of glycoproteins from the endoplasmic reticulum (ER). Its involvement in glycoprotein export suggests a regulatory function within the endoplasmic reticulum. LMAN2L Protein, Human (HEK293, His) is the recombinant human-derived LMAN2L protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The LMAN2L protein plays a critical role in cellular processes and may regulate the export of a specific subset of glycoproteins from the endoplasmic reticulum (ER). Its involvement in glycoprotein export suggests a regulatory function within the endoplasmic reticulum. LMAN2L Protein, Human (HEK293, His) is the recombinant human-derived LMAN2L protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The LMAN2L protein appears to play a crucial role in cellular processes, potentially participating in the regulation of export from the endoplasmic reticulum (ER) for a specific subset of glycoproteins. Its involvement in the intricate process of glycoprotein export suggests a regulatory function within the ER. Furthermore, LMAN2L may act as a regulator of ERGIC-53, implicating its role in the control of protein trafficking between the ER and the ER-Golgi intermediate compartment (ERGIC). These dual functionalities underscore the significance of LMAN2L in cellular mechanisms, particularly in the orchestration of glycoprotein export and the regulation of ERGIC-53, highlighting its potential impact on intracellular protein transport and cellular homeostasis.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9H0V9-1 (G45-A313)
-
Molecular Construction
-
N-term
-
LMAN2L (G45-A313)
Accession # Q9H0V9-1 -
6*His
-
C-term
-
-
Protein Length
Lumenal Domain
-
Synonyms
LMAN2L; Lectin, Mannose-Binding 2-Like; Lectin, Mannose Binding 2 Like; Lectin Mannose-Binding 2-Like; VIPL; VIP36-Like; VIP36-Like Protein; MRD69; LMAN2-Like Protein; MRT52; DKFZp564L2423
-
AA Sequence
GQTFEYLKREHSLSKPYQGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLPEMTAPLPPLSGLA
-
Predicted Molecular Mass
34.4 kDa
-
Molecular Weight
Approximately 30-45 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
