LMAN2L Protein, Human (295a.a, HEK293, His)

The LMAN2L protein plays a critical role in cellular processes and may regulate the export of a specific subset of glycoproteins from the endoplasmic reticulum (ER). Its involvement in glycoprotein export suggests a regulatory function within the endoplasmic reticulum. LMAN2L Protein, Human (295a.a, HEK293, His) is the recombinant human-derived LMAN2L protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LMAN2L Protein, Human (295a.a, HEK293, His) is 295 a.a., with molecular weight of 30-40 kDa.

The LMAN2L protein appears to play a crucial role in cellular processes, potentially participating in the regulation of export from the endoplasmic reticulum (ER) for a specific subset of glycoproteins. Its involvement in the intricate process of glycoprotein export suggests a regulatory function within the ER. Furthermore, LMAN2L may act as a regulator of ERGIC-53, implicating its role in the control of protein trafficking between the ER and the ER-Golgi intermediate compartment (ERGIC). These dual functionalities underscore the significance of LMAN2L in cellular mechanisms, particularly in the orchestration of glycoprotein export and the regulation of ERGIC-53, highlighting its potential impact on intracellular protein transport and cellular homeostasis.

Human

HEK293

C-6*His

Q9H0V9 (S19-A313)

81562  [NCBI]

SARDGSRMLLLLLLLGSGQGPQQVGAGQTFEYLKREHSLSKPYQGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLPEMTAPLPPLSGLA

30-40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.