LMW-PTP/ACP1 Protein, Human (His)
Based on 1 Customer Validation
LMW-PTP/ACP1, a phosphatase, acts on tyrosine phosphorylated proteins, low-molecular-weight aryl phosphates, and natural and synthetic acyl phosphates. Notably, there are substrate specificity differences between isoform 1 and isoform 2, with isoform 2 lacking phosphatase activity. LMW-PTP/ACP1 Protein, Human (His) is the recombinant human-derived LMW-PTP/ACP1 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LMW-PTP/ACP1, a phosphatase, acts on tyrosine phosphorylated proteins, low-molecular-weight aryl phosphates, and natural and synthetic acyl phosphates. Notably, there are substrate specificity differences between isoform 1 and isoform 2, with isoform 2 lacking phosphatase activity. LMW-PTP/ACP1 Protein, Human (His) is the recombinant human-derived LMW-PTP/ACP1 protein, expressed by E. coli , with C-6*His labeled tag.
Background
LMW-PTP (Low Molecular Weight Protein Tyrosine Phosphatase), also known as ACP1, functions as a phosphatase acting on tyrosine phosphorylated proteins, low-molecular-weight aryl phosphates, and both natural and synthetic acyl phosphates. Notably, there are differences in substrate specificity between isoform 1 and isoform 2. It's important to highlight that isoform 2 does not possess phosphatase activity.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P24666-2 (A2-H158)
-
Molecular Construction
-
N-term
-
ACP1 (A2-H158)
Accession # P24666-2 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
ACP1; Red Cell Acid Phosphatase 1; Acid Phosphatase 1; Adipocyte Acid Phosphatase; LMW-PTP; LMW-PTPase; Low Molecular Weight Phosphotyrosine Protein Phosphatase; Cytoplasmic Phosphotyrosyl Protein Phosphatase; LMWPTP; Protein-Tyrosine-Phosphatase, Isoform
-
AA Sequence
AEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
-
Predicted Molecular Mass
17.8 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
