1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. LMW-PTP/ACP1 Protein, Human (C-His)

LMW-PTP/ACP1 Protein, Human (C-His)

Cat. No.: HY-P70327A
COA Handling Instructions

LMW-PTP/ACP1, a phosphatase, acts on tyrosine phosphorylated proteins, low-molecular-weight aryl phosphates, and natural and synthetic acyl phosphates. Notably, there are substrate specificity differences between isoform 1 and isoform 2, with isoform 2 lacking phosphatase activity. LMW-PTP/ACP1 Protein, Human (C-His) is the recombinant human-derived LMW-PTP/ACP1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of LMW-PTP/ACP1 Protein, Human (C-His) is 157 a.a., with molecular weight of ~18.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $67 In-stock
10 μg $114 In-stock
50 μg $320 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LMW-PTP/ACP1, a phosphatase, acts on tyrosine phosphorylated proteins, low-molecular-weight aryl phosphates, and natural and synthetic acyl phosphates. Notably, there are substrate specificity differences between isoform 1 and isoform 2, with isoform 2 lacking phosphatase activity. LMW-PTP/ACP1 Protein, Human (C-His) is the recombinant human-derived LMW-PTP/ACP1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of LMW-PTP/ACP1 Protein, Human (C-His) is 157 a.a., with molecular weight of ~18.0 kDa.

Background

LMW-PTP (Low Molecular Weight Protein Tyrosine Phosphatase), also known as ACP1, functions as a phosphatase acting on tyrosine phosphorylated proteins, low-molecular-weight aryl phosphates, and both natural and synthetic acyl phosphates. Notably, there are differences in substrate specificity between isoform 1 and isoform 2. It's important to highlight that isoform 2 does not possess phosphatase activity.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P24666-2 (A2-H158)

Gene ID

52  [NCBI]

Molecular Construction
N-term
ACP1 (A2-H158)
Accession # P24666-2
6*His
C-term
Synonyms
rHuLow molecular weight phosphotyrosine protein phosphatase/LMW-PTP, His; Low Molecular Weight Phosphotyrosine Protein Phosphatase; LMW-PTP; LMW-PTPase; Adipocyte Acid Phosphatase; Low Molecular Weight Cytosolic Acid Phosphatase; Red Cell Acid Phosphatase 1; ACP1
AA Sequence

AEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH

Molecular Weight

Approximately 18.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LMW-PTP/ACP1 Protein, Human (C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LMW-PTP/ACP1 Protein, Human (C-His)
Cat. No.:
HY-P70327A
Quantity:
MCE Japan Authorized Agent: