LRG1 Protein, Human (HEK293, Fc-His)

Leucine-rich alpha-2-glycoprotein (encoded by LRG1) is a serum biomarkerof inflammatory bowel disease and various autoimmune diseases. LRG1 can bind to TGF-β1 (K_D: 2.32 µM) and modulate the TGFβ pathway^[1][2][3]. LRG1 Protein, Human (HEK293, Fc-His) is the recombinant human-derived LRG1 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

Leucine-rich alpha-2-glycoprotein (encoded by LRG1), an approximately 50 kDa glycoprotein, is a serum biomarkerof inflammatory bowel disease and various autoimmune diseases. LRG1 can bind to TGF-β1 (K_D: 2.32 µM) and modulate the TGFβ pathway, and promotes ECM integrity by activating the TGF-beta signaling pathway in fibroblasts^[1]. LRG1 is usually secreted by neutrophils undergoing differentiation and by liver cells^[2].
Besides, LRG1 enhances TGFβ1-smad1/5/8 signaling in the presence of endoglin in endothelial cells. LRG1 also promotes TGFβ1-induced apoptosis^[3].

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Cytochrome c is immobilized at 1µg/mL(100 µL/well) can bind Biotinylated Human LRG1. The ED₅₀ for this effect is 8.019 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Cytochrome c is immobilized at 1µg/mL(100 µL/well) can bind Biotinylated Human LRG1. The ED₅₀ for this effect is 8.019 ng/mL.

Human

HEK293

C-hFc;C-6*His

P02750/AAH70198.1 (V36-Q347)

116844  [NCBI]

Full Length of Mature Protein

VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ

65-90 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 200 mM NaCl, 10% Glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.