LSM4 Protein, Human (His)

The LSM4 protein plays a crucial role in pre-mRNA splicing, participating in the U4/U6-U5 tri-snRNP complex during spliceosome assembly, and as a component of the precatalytic spliceosome (spliceosome B complex). In the heptameric LSM2-8 complex, LSM4 specifically binds to the 3' U region of U6 snRNA. LSM4 Protein, Human (His) is the recombinant human-derived LSM4 protein, expressed by E. coli , with N-6*His labeled tag. The total length of LSM4 Protein, Human (His) is 139 a.a., with molecular weight of ~17.0 kDa.

LSM4 protein plays a crucial role in pre-mRNA splicing, functioning as a key component of the U4/U6-U5 tri-snRNP complex involved in spliceosome assembly and the precatalytic spliceosome (spliceosome B complex). Alongside LSM2, LSM3, LSM5, LSM6, LSM7, and LSM8, LSM4 forms the heptameric LSM2-8 complex, which specifically binds to the 3'-terminal U-tract of U6 snRNA. This complex is an integral part of the U4/U6-U5 tri-snRNP complex, a fundamental building block in the intricate machinery orchestrating spliceosome assembly. The U4/U6-U5 tri-snRNP complex comprises various snRNAs and associated proteins, underscoring LSM4's essential contribution to the complex and highly regulated process of pre-mRNA splicing.

Human

E. coli

N-6*His

Q9Y4Z0 (M1-Q139)

25804  [NCBI]

MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ

Approximately 17.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.