2. Recombinant Proteins
  3. Others
  4. LYPD3/C4.4A Protein, Human (HEK293, His)

LYPD3/C4.4A Protein, Human (HEK293, His)

Cat. No.: HY-P70219
Handling Instructions

LYPD3/C4.4A protein facilitates cell migration and potentially influences urothelial cell-matrix interactions. It plays a role in tumor progression, binding to laminin-1 and laminin-5. Interactions with LGALS3, AGR2, and AGR3 emphasize its functional associations and impact in diverse biological processes. LYPD3/C4.4A Protein, Human (HEK293, His) is the recombinant human-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LYPD3/C4.4A Protein, Human (HEK293, His) is 256 a.a., with molecular weight of 55-75 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LYPD3/C4.4A protein facilitates cell migration and potentially influences urothelial cell-matrix interactions. It plays a role in tumor progression, binding to laminin-1 and laminin-5. Interactions with LGALS3, AGR2, and AGR3 emphasize its functional associations and impact in diverse biological processes. LYPD3/C4.4A Protein, Human (HEK293, His) is the recombinant human-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LYPD3/C4.4A Protein, Human (HEK293, His) is 256 a.a., with molecular weight of 55-75 kDa.
Background

The LYPD3/C4.4A protein supports cell migration and may play a role in urothelial cell-matrix interactions. It is also implicated in tumor progression and has been shown to bind to laminin-1 and laminin-5. Additionally, it interacts with LGALS3, AGR2, and AGR3, further highlighting its functional associations and potential impact in various biological processes.
Species

Human
Source

HEK293
Tag

C-6*His
Accession

O95274 (L31-H286)
Gene ID
Molecular Construction
N-term
LYPD3 (L31-H286)
Accession # O95274
6*His
C-term
Synonyms
rHuLy6/PLAUR domain-containing protein 3, His; Ly6/PLAUR Domain-Containing Protein 3; GPI-Anchored Metastasis-Associated Protein C4.4A Homolog; Matrigel-Induced Gene C4 Protein; MIG-C4; LYPD3; C4.4A
AA Sequence

LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEH

Molecular Weight

55-75 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

LYPD3/C4.4A Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LYPD3/C4.4A Protein, Human (HEK293, His)
Cat. No.:
HY-P70219
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.