LYPD3/C4.4A Protein, Human (HEK293, His)
LYPD3/C4.4A protein facilitates cell migration and potentially influences urothelial cell-matrix interactions.It plays a role in tumor progression, binding to laminin-1 and laminin-5.Interactions with LGALS3, AGR2, and AGR3 emphasize its functional associations and impact in diverse biological processes.LYPD3/C4.4A Protein, Human (HEK293, His) is the recombinant human-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LYPD3/C4.4A protein facilitates cell migration and potentially influences urothelial cell-matrix interactions.It plays a role in tumor progression, binding to laminin-1 and laminin-5.Interactions with LGALS3, AGR2, and AGR3 emphasize its functional associations and impact in diverse biological processes.LYPD3/C4.4A Protein, Human (HEK293, His) is the recombinant human-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The LYPD3/C4.4A protein supports cell migration and may play a role in urothelial cell-matrix interactions. It is also implicated in tumor progression and has been shown to bind to laminin-1 and laminin-5. Additionally, it interacts with LGALS3, AGR2, and AGR3, further highlighting its functional associations and potential impact in various biological processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
O95274 (L31-H286)
-
Molecular Construction
-
N-term
-
LYPD3 (L31-H286)
Accession # O95274 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
LYPD3; Matrigel-Induced Gene C4 Protein; LY6/PLAUR Domain Containing 3; MIG-C4; C4.4A; GPI-Anchored Metastasis-Associated Protein Homolog; Ly6/PLAUR Domain-Containing Protein 3; 2310061G07Rik; GPI-Anchored Metastasis-Associated Protein C4.4A Homolog
-
AA Sequence
LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEH
-
Predicted Molecular Mass
27.9 kDa
-
Molecular Weight
Approximately 45-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
