LYPD3/C4.4A Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The LYPD3/C4.4A protein is a multifunctional cell surface molecule that is critical for cell migration and has been implicated in potential tumor progression. It binds laminin 1 and laminin 5, emphasizing its role in extracellular matrix interactions. LYPD3/C4.4A Protein, Mouse (HEK293, His) is the recombinant mouse-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The LYPD3/C4.4A protein is a multifunctional cell surface molecule that is critical for cell migration and has been implicated in potential tumor progression. It binds laminin 1 and laminin 5, emphasizing its role in extracellular matrix interactions. LYPD3/C4.4A Protein, Mouse (HEK293, His) is the recombinant mouse-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-His labeled tag.
Background
LYPD3/C4.4A protein, a versatile cell surface molecule, plays a crucial role in supporting cell migration and is implicated in potential contributions to tumor progression. This protein exhibits binding affinity for laminin-1 and laminin-5, highlighting its involvement in interactions with extracellular matrix components. Additionally, LYPD3/C4.4A interacts with LGALS3, suggesting a role in cellular processes influenced by galectin interactions. Furthermore, its association with AGR2 and AGR3 implies potential involvement in pathways related to tumor development and progression. The multifaceted interactions of LYPD3/C4.4A underscore its significance in cellular dynamics and its potential impact on pathological processes, particularly in the context of tumor biology.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When LYPD3 is immobilized at 0.5 μg/mL (100 μL/well), Galectin-3 binds with an apparent KD is 109.3nM.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q91YK8 (L33-H287)
-
Molecular Construction
-
N-term
-
LYPD3 (L33-H287)
Accession # Q91YK8 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
LYPD3; Matrigel-Induced Gene C4 Protein; LY6/PLAUR Domain Containing 3; MIG-C4; C4.4A; GPI-Anchored Metastasis-Associated Protein Homolog; Ly6/PLAUR Domain-Containing Protein 3; 2310061G07Rik; GPI-Anchored Metastasis-Associated Protein C4.4A Homolog
-
AA Sequence
LECYSCVQKADDGCSPHRMKTVKCGPGVDVCTEAVGAVETIHGQFSVAVRGCGSGIPGKNDRGLDLHGLLAFFQLQQCSEDRCNAKLNLTLRGLNPAGNESAYEPNGAECYSCVGLSREKCQGSMPPVVNCYNASGRVYKGCFDGNVTLTAANVTVSLPVRGCVQDETCTRDGVTGPGFTLSGSCCQGPRCNADLRNKTYFSPRIPPLVLLPPPTTAAPSTRAQNSSSTTSTAAPTTTTSIIKPTTAQASHTSPH
-
Molecular Weight
Approximately 55-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)