LYPD3/C4.4A Protein, Mouse (HEK293, His)

The LYPD3/C4.4A protein is a multifunctional cell surface molecule that is critical for cell migration and has been implicated in potential tumor progression. It binds laminin 1 and laminin 5, emphasizing its role in extracellular matrix interactions. LYPD3/C4.4A Protein, Mouse (HEK293, His) is the recombinant mouse-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-His labeled tag. The total length of LYPD3/C4.4A Protein, Mouse (HEK293, His) is 255 a.a., with molecular weight of ~45-75 kDa.

LYPD3/C4.4A protein, a versatile cell surface molecule, plays a crucial role in supporting cell migration and is implicated in potential contributions to tumor progression. This protein exhibits binding affinity for laminin-1 and laminin-5, highlighting its involvement in interactions with extracellular matrix components. Additionally, LYPD3/C4.4A interacts with LGALS3, suggesting a role in cellular processes influenced by galectin interactions. Furthermore, its association with AGR2 and AGR3 implies potential involvement in pathways related to tumor development and progression. The multifaceted interactions of LYPD3/C4.4A underscore its significance in cellular dynamics and its potential impact on pathological processes, particularly in the context of tumor biology.

Measured by its binding ability in a functional ELISA. When LYPD3 is immobilized at 0.5 μg/mL (100 μL/well), Galectin-3 binds with an apparent KD is 109.3nM.

• 
  Measured by its binding ability in a functional ELISA. When LYPD3 is immobilized at 0.5 μg/mL (100 μL/well), Galectin-3 binds with an apparent KD is 109.3 nM.

Mouse

HEK293

C-His

Q91YK8 (L33-H287)

72434  [NCBI]

LECYSCVQKADDGCSPHRMKTVKCGPGVDVCTEAVGAVETIHGQFSVAVRGCGSGIPGKNDRGLDLHGLLAFFQLQQCSEDRCNAKLNLTLRGLNPAGNESAYEPNGAECYSCVGLSREKCQGSMPPVVNCYNASGRVYKGCFDGNVTLTAANVTVSLPVRGCVQDETCTRDGVTGPGFTLSGSCCQGPRCNADLRNKTYFSPRIPPLVLLPPPTTAAPSTRAQNSSSTTSTAAPTTTTSIIKPTTAQASHTSPH

The protein migrates as approximately 45-75 kDa under reducing SDS-PAGE due to glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.