Copy Link Print Information

LYPD3/C4.4A Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

The LYPD3/C4.4A protein is a multifunctional cell surface molecule that is critical for cell migration and has been implicated in potential tumor progression. It binds laminin 1 and laminin 5, emphasizing its role in extracellular matrix interactions. LYPD3/C4.4A Protein, Mouse (HEK293, His) is the recombinant mouse-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for LYPD3/C4.4A Protein, Mouse (HEK293, His)
  • Experimental Validation Results for LYPD3/C4.4A Protein, Mouse (HEK293, His)
  • LYPD3/C4.4A Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The LYPD3/C4.4A protein is a multifunctional cell surface molecule that is critical for cell migration and has been implicated in potential tumor progression. It binds laminin 1 and laminin 5, emphasizing its role in extracellular matrix interactions. LYPD3/C4.4A Protein, Mouse (HEK293, His) is the recombinant mouse-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-His labeled tag.

Background

LYPD3/C4.4A protein, a versatile cell surface molecule, plays a crucial role in supporting cell migration and is implicated in potential contributions to tumor progression. This protein exhibits binding affinity for laminin-1 and laminin-5, highlighting its involvement in interactions with extracellular matrix components. Additionally, LYPD3/C4.4A interacts with LGALS3, suggesting a role in cellular processes influenced by galectin interactions. Furthermore, its association with AGR2 and AGR3 implies potential involvement in pathways related to tumor development and progression. The multifaceted interactions of LYPD3/C4.4A underscore its significance in cellular dynamics and its potential impact on pathological processes, particularly in the context of tumor biology.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When LYPD3 is immobilized at 0.5 μg/mL (100 μL/well), Galectin-3 binds with an apparent KD is 109.3nM.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When LYPD3 is immobilized at 0.5 μg/mL (100 μL/well), Galectin-3 binds with an apparent KD is 109.3 nM.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    Q91YK8 (L33-H287)

  • Gene ID
    72434  [NCBI]
  • Molecular Construction
    • N-term
    • LYPD3 (L33-H287)
      Accession # Q91YK8
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    LYPD3; Matrigel-Induced Gene C4 Protein; LY6/PLAUR Domain Containing 3; MIG-C4; C4.4A; GPI-Anchored Metastasis-Associated Protein Homolog; Ly6/PLAUR Domain-Containing Protein 3; 2310061G07Rik; GPI-Anchored Metastasis-Associated Protein C4.4A Homolog

  • AA Sequence

    LECYSCVQKADDGCSPHRMKTVKCGPGVDVCTEAVGAVETIHGQFSVAVRGCGSGIPGKNDRGLDLHGLLAFFQLQQCSEDRCNAKLNLTLRGLNPAGNESAYEPNGAECYSCVGLSREKCQGSMPPVVNCYNASGRVYKGCFDGNVTLTAANVTVSLPVRGCVQDETCTRDGVTGPGFTLSGSCCQGPRCNADLRNKTYFSPRIPPLVLLPPPTTAAPSTRAQNSSSTTSTAAPTTTTSIIKPTTAQASHTSPH

  • Molecular Weight

    Approximately 55-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When LYPD3 is immobilized at 0.5 μg/mL (100 μL/well), Galectin-3 binds with an apparent KD is 109.3 nM.

  • LYPD3/C4.4A Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for LYPD3/C4.4A Protein, Mouse (HEK293, His)
  • Experimental Validation Results for LYPD3/C4.4A Protein, Mouse (HEK293, His)
  • LYPD3/C4.4A Protein, Mouse (HEK293, His) Product Image