LYVE-1 Protein, Mouse (HEK293, Fc)

The LYVE-1 protein is a ligand-specific transporter that regulates molecular transport between the trans-Golgi network (TGN) and the plasma membrane. It plays a key role in autocrine cell growth regulation, mediating the uptake and catabolism of growth regulators through cell surface retention sequences. LYVE-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived LYVE-1 protein, expressed by HEK293 , with C-hFc labeled tag.

LYVE-1, a ligand-specific transporter, orchestrates the trafficking of molecules between intracellular organelles, specifically the trans-Golgi network (TGN), and the plasma membrane. Functioning as a key player in the autocrine regulation of cell growth, LYVE-1 is involved in mediating the uptake and catabolism of growth regulators containing a cell surface retention sequence binding (CRS). Additionally, it exhibits potential as a hyaluronan (HA) transporter, participating in the internalization of HA for catabolism within lymphatic endothelial cells or its transport into the lumen of afferent lymphatic vessels, leading to subsequent re-uptake and degradation in lymph nodes. Moreover, LYVE-1 forms homodimers through disulfide linkages and binds to pericellular hyaluronan matrices on leukocytes, facilitating cell adhesion and migration through lymphatic endothelium. It interacts with PDGFB and IGFBP3 and transiently forms a ternary complex with PDGFB and PDGFRB in the TGN.

Measured by its binding ability in a functional ELISA. When LYVE-1 is present at 10 μg/mL can bind hyaluronan. The ED₅₀ for this effect is 19.33 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When LYVE-1 is present at 10 μg/mL can bind hyaluronan. The ED₅₀ for this effect is 19.33 μg/mL.

Mouse

HEK293

C-hFc

Q8BHC0 (A24-G228)

114332  [NCBI]

Partial

ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAG

Approximately 60-90 kDa due to the glycosylation

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.