1. Recombinant Proteins
  2. Receptor Proteins
  3. LYVE-1 Protein, Mouse (HEK293, Fc)

LYVE-1 Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P74764
COA Handling Instructions

The LYVE-1 protein is a ligand-specific transporter that regulates molecular transport between the trans-Golgi network (TGN) and the plasma membrane. It plays a key role in autocrine cell growth regulation, mediating the uptake and catabolism of growth regulators through cell surface retention sequences. LYVE-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived LYVE-1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of LYVE-1 Protein, Mouse (HEK293, Fc) is 205 a.a., with molecular weight of ~63 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $60 In-stock
10 μg $100 In-stock
50 μg $280 In-stock
100 μg $480 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LYVE-1 protein is a ligand-specific transporter that regulates molecular transport between the trans-Golgi network (TGN) and the plasma membrane. It plays a key role in autocrine cell growth regulation, mediating the uptake and catabolism of growth regulators through cell surface retention sequences. LYVE-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived LYVE-1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of LYVE-1 Protein, Mouse (HEK293, Fc) is 205 a.a., with molecular weight of ~63 kDa.

Background

LYVE-1, a ligand-specific transporter, orchestrates the trafficking of molecules between intracellular organelles, specifically the trans-Golgi network (TGN), and the plasma membrane. Functioning as a key player in the autocrine regulation of cell growth, LYVE-1 is involved in mediating the uptake and catabolism of growth regulators containing a cell surface retention sequence binding (CRS). Additionally, it exhibits potential as a hyaluronan (HA) transporter, participating in the internalization of HA for catabolism within lymphatic endothelial cells or its transport into the lumen of afferent lymphatic vessels, leading to subsequent re-uptake and degradation in lymph nodes. Moreover, LYVE-1 forms homodimers through disulfide linkages and binds to pericellular hyaluronan matrices on leukocytes, facilitating cell adhesion and migration through lymphatic endothelium. It interacts with PDGFB and IGFBP3 and transiently forms a ternary complex with PDGFB and PDGFRB in the TGN.

Biological Activity

Measured by its binding ability in a functional ELISA. When LYVE-1 is present at 10 μg/mL can bind hyaluronan. The ED50 for this effect is 19.33 μg/mL.

  • Measured by its binding ability in a functional ELISA. When LYVE-1 is present at 10 μg/mL can bind hyaluronan. The ED50 for this effect is 19.33 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q8BHC0 (A24-G228)

Gene ID

114332  [NCBI]

Molecular Construction
N-term
LYVE-1 (A24-G228)
Accession # Q8BHC0
hFc
C-term
Synonyms
Lymphatic vessel endothelial hyaluronic acid receptor 1; LYVE-1; CRSBP-1
AA Sequence

ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAG

Molecular Weight

Approximately 60-90 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LYVE-1 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LYVE-1 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P74764
Quantity:
MCE Japan Authorized Agent: