CD68 Protein, Human (HEK293, Fc)

CD68 protein is essential for phagocytic activities in tissue macrophages, including lysosomal metabolism and interactions with cells and pathogens. It binds to lectins or selectins, aiding targeted migration of specific macrophage subsets. CD68's rapid recirculation from endosomes and lysosomes to the plasma membrane allows macrophages to crawl or interact with selectin-bearing substrates and other cells. CD68 Protein, Human (HEK293, Fc) is the recombinant human-derived CD68 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD68 Protein, Human (HEK293, Fc) is 299 a.a., with molecular weight of 70-100 kDa.

CD68 protein is thought to play a crucial role in various phagocytic activities carried out by tissue macrophages, encompassing intracellular lysosomal metabolism as well as extracellular interactions with cells and pathogens. It has the ability to bind to tissue- and organ-specific lectins or selectins, facilitating the targeted migration of specific macrophage subsets to particular sites. The rapid recirculation of CD68 from endosomes and lysosomes to the plasma membrane enables macrophages to crawl over selectin-bearing substrates or interact with other cells.

Human

HEK293

C-hFc

P34810 (N22-I320)

968  [NCBI]

NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRSI

70-100 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.