MAP1LC3A Protein, Human (His)

MAP1LC3A is a key ubiquitin-like modifier essential for autophagosome vacuole formation, ensuring cellular homeostasis. As part of the GABARAP/GATE-16 subfamily, it plays a crucial role in late autophagosome maturation. MAP1LC3A Protein, Human (His) is the recombinant human-derived MAP1LC3A protein, expressed by E. coli , with C-6*His labeled tag. The total length of MAP1LC3A Protein, Human (His) is 121 a.a., with molecular weight of ~16.0 kDa.

MAP1LC3A, a ubiquitin-like modifier, plays a crucial role in autophagosomal vacuole formation, contributing to cellular homeostasis. While participating in the elongation of the phagophore membrane, MAP1LC3A, belonging to the GABARAP/GATE-16 subfamily, assumes a vital role in the later stages of autophagosome maturation. It engages in the remodeling of endoplasmic reticulum subdomains into autophagosomes in response to nutrient stress, facilitating their subsequent fusion with lysosomes for endoplasmic reticulum turnover. With three different light chains (LC1, LC2, and LC3), it can associate with MAP1A and MAP1B proteins. MAP1LC3A exhibits a diverse interactome, engaging with proteins like TP53INP1, TP53INP2, SQSTM1 for inclusion body degradation, ATG13, ULK1, TBC1D5, UBQLN1, UBQLN2, UBQLN4, TRIM5, MEFV, and others. These interactions underscore the multifaceted role of MAP1LC3A in various cellular processes, including autophagy, protein aggregate degradation, and the regulation of reticulophagy.

Human

E. coli

C-6*His

Q9H492 (M1-F121)

84557  [NCBI]

MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF

Approximately 16.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.