MAP1LC3A Protein, Human (His)
MAP1LC3A is a key ubiquitin-like modifier essential for autophagosome vacuole formation, ensuring cellular homeostasis. As part of the GABARAP/GATE-16 subfamily, it plays a crucial role in late autophagosome maturation. MAP1LC3A Protein, Human (His) is the recombinant human-derived MAP1LC3A protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
Biological Activity
MAP1LC3A is a key ubiquitin-like modifier essential for autophagosome vacuole formation, ensuring cellular homeostasis. As part of the GABARAP/GATE-16 subfamily, it plays a crucial role in late autophagosome maturation. MAP1LC3A Protein, Human (His) is the recombinant human-derived MAP1LC3A protein, expressed by E. coli , with C-6*His labeled tag.
MAP1LC3A, a ubiquitin-like modifier, plays a crucial role in autophagosomal vacuole formation, contributing to cellular homeostasis. While participating in the elongation of the phagophore membrane, MAP1LC3A, belonging to the GABARAP/GATE-16 subfamily, assumes a vital role in the later stages of autophagosome maturation. It engages in the remodeling of endoplasmic reticulum subdomains into autophagosomes in response to nutrient stress, facilitating their subsequent fusion with lysosomes for endoplasmic reticulum turnover. With three different light chains (LC1, LC2, and LC3), it can associate with MAP1A and MAP1B proteins. MAP1LC3A exhibits a diverse interactome, engaging with proteins like TP53INP1, TP53INP2, SQSTM1 for inclusion body degradation, ATG13, ULK1, TBC1D5, UBQLN1, UBQLN2, UBQLN4, TRIM5, MEFV, and others. These interactions underscore the multifaceted role of MAP1LC3A in various cellular processes, including autophagy, protein aggregate degradation, and the regulation of reticulophagy.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q9H492-1 (M1-F121)
-
Molecular Construction
-
N-term
-
MAP1LC3A (M1-F121)
Accession # Q9H492-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MAP1LC3A; Microtubule-Associated Proteins 1A/1B Light Chain 3A; Microtubule Associated Protein 1 Light Chain 3 Alpha; Autophagy-Related Ubiquitin-Like Modifier LC3 A; MAP1BLC3; MAP1 Light Chain 3-Like Protein 1; MAP1ALC3; MAP1A/MAP1B Light Chain 3 A; ATG8
-
AA Sequence
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF
-
Predicted Molecular Mass
15.3 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)