MAP1LC3A Protein, Human (His)

MAP1LC3A is a key ubiquitin-like modifier essential for autophagosome vacuole formation, ensuring cellular homeostasis. As part of the GABARAP/GATE-16 subfamily, it plays a crucial role in late autophagosome maturation. MAP1LC3A Protein, Human (His) is the recombinant human-derived MAP1LC3A protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

MAP1LC3A is a key ubiquitin-like modifier essential for autophagosome vacuole formation, ensuring cellular homeostasis. As part of the GABARAP/GATE-16 subfamily, it plays a crucial role in late autophagosome maturation. MAP1LC3A Protein, Human (His) is the recombinant human-derived MAP1LC3A protein, expressed by E. coli , with C-6*His labeled tag.

Background

MAP1LC3A, a ubiquitin-like modifier, plays a crucial role in autophagosomal vacuole formation, contributing to cellular homeostasis. While participating in the elongation of the phagophore membrane, MAP1LC3A, belonging to the GABARAP/GATE-16 subfamily, assumes a vital role in the later stages of autophagosome maturation. It engages in the remodeling of endoplasmic reticulum subdomains into autophagosomes in response to nutrient stress, facilitating their subsequent fusion with lysosomes for endoplasmic reticulum turnover. With three different light chains (LC1, LC2, and LC3), it can associate with MAP1A and MAP1B proteins. MAP1LC3A exhibits a diverse interactome, engaging with proteins like TP53INP1, TP53INP2, SQSTM1 for inclusion body degradation, ATG13, ULK1, TBC1D5, UBQLN1, UBQLN2, UBQLN4, TRIM5, MEFV, and others. These interactions underscore the multifaceted role of MAP1LC3A in various cellular processes, including autophagy, protein aggregate degradation, and the regulation of reticulophagy.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • MAP1LC3A (M1-F121)
      Accession # Q9H492-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    MAP1LC3A; Microtubule-Associated Proteins 1A/1B Light Chain 3A; Microtubule Associated Protein 1 Light Chain 3 Alpha; Autophagy-Related Ubiquitin-Like Modifier LC3 A; MAP1BLC3; MAP1 Light Chain 3-Like Protein 1; MAP1ALC3; MAP1A/MAP1B Light Chain 3 A; ATG8

  • AA Sequence

    MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF

  • Predicted Molecular Mass

    15.3 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00