MAP1LC3B Protein, Human
Based on 1 publication(s) in Google Scholar
MAP1LC3B is a key ubiquitin-like modifier essential for the formation of autophagosome vacuoles, which maintains cellular homeostasis. In mitophagy, it regulates mitochondrial number, suppresses reactive oxygen species and ensures energy efficiency. MAP1LC3B Protein, Human is the recombinant human-derived MAP1LC3B protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
MAP1LC3B is a key ubiquitin-like modifier essential for the formation of autophagosome vacuoles, which maintains cellular homeostasis. In mitophagy, it regulates mitochondrial number, suppresses reactive oxygen species and ensures energy efficiency. MAP1LC3B Protein, Human is the recombinant human-derived MAP1LC3B protein, expressed by E. coli , with tag free.
MAP1LC3B, a ubiquitin-like modifier, plays a pivotal role in autophagosomal vacuole formation, contributing to cellular homeostasis. Engaging in mitophagy, it regulates mitochondrial quantity and quality, preventing excess reactive oxygen species production and ensuring energy efficiency. During cellular stress, it binds C-18 ceramides, anchoring autophagolysosomes to outer mitochondrial membranes, facilitating damaged mitochondria elimination. Distinct from LC3s involved in phagophore membrane elongation, the GABARAP/GATE-16 subfamily, to which MAP1LC3B belongs, is crucial for later-stage autophagosome maturation. MAP1LC3B further promotes primary ciliogenesis and orchestrates the remodeling of endoplasmic reticulum subdomains into autophagosomes via interactions with TEX264. In response to nutrient stress, it recruits cofactor JMY, enhancing actin nucleation and autophagosome biogenesis. This versatile protein interacts with a multitude of partners, including SQSTM1 for inclusion body degradation, ATG13, MAPK15, BNIP3, KEAP1, PCM1, and TBC1D5, highlighting its involvement in diverse cellular processes and signaling pathways.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Nat Commun
DSS1 inhibits autophagy to activate epithelial-mesenchymal transition in a pro-metastatic niche of renal cell carcinoma. [Abstract]2025 Jul 23;16(1):6769. PMID: 40695833
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9GZQ8 (M1-V125)
-
Molecular Construction
-
N-term
-
MAP1LC3B (M1-V125)
Accession # Q9GZQ8 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Microtubule-associated proteins 1A/1B light chain 3B; Autophagy-related protein LC3 B; Autophagy-related ubiquitin-like modifier LC3 B; MAP1 light chain 3-like protein 2; MAP1A/MAP1B light chain 3 B; MAP1A/MAP1B LC3 B; Microtubule-associated protein 1 light cha
-
AA Sequence
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
-
Molecular Weight
Approximately 14-19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM Citrate, 15% trehalose, 0.05% Tween 80, 2 mM DTT, pH 4.0
.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
