MAP1LC3B Protein, Human

MAP1LC3B is a key ubiquitin-like modifier essential for the formation of autophagosome vacuoles, which maintains cellular homeostasis. In mitophagy, it regulates mitochondrial number, suppresses reactive oxygen species and ensures energy efficiency. MAP1LC3B Protein, Human is the recombinant human-derived MAP1LC3B protein, expressed by E. coli , with tag free. The total length of MAP1LC3B Protein, Human is 125 a.a., with molecular weight of ~16.15 kDa.

MAP1LC3B, a ubiquitin-like modifier, plays a pivotal role in autophagosomal vacuole formation, contributing to cellular homeostasis. Engaging in mitophagy, it regulates mitochondrial quantity and quality, preventing excess reactive oxygen species production and ensuring energy efficiency. During cellular stress, it binds C-18 ceramides, anchoring autophagolysosomes to outer mitochondrial membranes, facilitating damaged mitochondria elimination. Distinct from LC3s involved in phagophore membrane elongation, the GABARAP/GATE-16 subfamily, to which MAP1LC3B belongs, is crucial for later-stage autophagosome maturation. MAP1LC3B further promotes primary ciliogenesis and orchestrates the remodeling of endoplasmic reticulum subdomains into autophagosomes via interactions with TEX264. In response to nutrient stress, it recruits cofactor JMY, enhancing actin nucleation and autophagosome biogenesis. This versatile protein interacts with a multitude of partners, including SQSTM1 for inclusion body degradation, ATG13, MAPK15, BNIP3, KEAP1, PCM1, and TBC1D5, highlighting its involvement in diverse cellular processes and signaling pathways.

Human

E. coli

Tag Free

Q9GZQ8 (M1-V125)

81631  [NCBI]

MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV

Approximately 16.15 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, 2 mM DTT, pH 8.0 .

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.