1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. TGF-β
  5. TGF-β1
  6. Mature TGF beta 1/TGFB1 Protein, Human (Biotinylated, HEK293, Avi)

Mature TGF beta 1/TGFB1 Protein, Human (Biotinylated, HEK293, Avi)

Cat. No.: HY-P78213
Handling Instructions Technical Support

TGF beta 1/TGFB1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. TGF beta 1 is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, apoptosis, and can regulate the expression and activation of other growth factors, including interferon gamma and tumor necrosis factor alpha. Mature TGF beta 1/TGFB1 Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived Mature TGF beta 1/TGFB1 protein, expressed by HEK293 , with C-Avi labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

3 Publications Citing Use of MCE Mature TGF beta 1/TGFB1 Protein, Human (Biotinylated, HEK293, Avi)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TGF beta 1/TGFB1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. TGF beta 1 is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, apoptosis, and can regulate the expression and activation of other growth factors, including interferon gamma and tumor necrosis factor alpha. Mature TGF beta 1/TGFB1 Protein, Human (Biotinylated, HEK293, Avi) is the recombinant human-derived Mature TGF beta 1/TGFB1 protein, expressed by HEK293 , with C-Avi labeled tag.

Background

Transforming growth factor (TGF) beta 1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. TGF beta 1 is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, apoptosis, and can regulate the expression and activation of other growth factors, including interferon gamma and tumor necrosis factor alpha. In humans, TGF-β1 is encoded by the TGFB1 gene. TGF beta 1 activates CREB3L1 by regulating intramembranous proteolysis, stimulating sustained collagen production. TGF beta 1 mediates SMAD2/3 activation by inducing SMAD2/3 phosphorylation and subsequent translocation to the nucleus and regulates dental papilla cells by promoting IPO7-mediated translocation of phosphorylated SMAD2 to the nucleus and subsequent transcription of target genes. TGF beta 1 induces epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types.TGF beta 1 plays an important role in controlling the immune system, and shows different activities on different types of cell, or cells at different developmental stages[1][2][3][4][5][6].

Biological Activity

Immobilized Human TGF-beta RII, hFc Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human Mature TGF beta 1, Avi Tag with the EC50 of ≤25.3 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-Avi

Accession

P01137 (A279-S390)

Gene ID
Molecular Construction
N-term
TGFB1 (A279-S390)
Accession # P01137
Avi
C-term
Protein Length

Full Length of Mature TGFB1

Conjugation

Biotin

Conjugate Method

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

Synonyms
CEDLAP; DPD1; TGF beta1; TGFB; TGFB1; TGFbeta; TGF-beta-1; TGF β1; TGFβ; TGF-β-1
AA Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Predicted Molecular Mass
13.2 kDa
Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Structure/Form
Homodimer
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM glycine, 150 mM NaCl, pH 2.5. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4 mM HCl.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Mature TGF beta 1/TGFB1 Protein, Human (Biotinylated, HEK293, Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Mature TGF beta 1/TGFB1 Protein, Human (Biotinylated, HEK293, Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Mature TGF beta 1/TGFB1 Protein, Human (Biotinylated, HEK293, Avi)
Cat. No.:
HY-P78213
Quantity:
MCE Japan Authorized Agent: