1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL22
  6. MDC/CCL22 Protein, Human (HEK293, Fc)

CCL22 (CC motif chemokine ligand 22) plays a critical role in guiding activated/effector T lymphocytes to sites of inflammation and affects various aspects of T lymphocyte physiology. It has chemotactic activity against monocytes, dendritic cells, and natural killer cells, acts as a mild chemoattractant for primary activated T lymphocytes, and acts as a potent chemoattractant for chronically activated counterparts. MDC/CCL22 Protein, Human (HEK293, Fc) is the recombinant human-derived MDC/CCL22 protein, expressed by HEK293, with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CCL22 (CC motif chemokine ligand 22) plays a critical role in guiding activated/effector T lymphocytes to sites of inflammation and affects various aspects of T lymphocyte physiology. It has chemotactic activity against monocytes, dendritic cells, and natural killer cells, acts as a mild chemoattractant for primary activated T lymphocytes, and acts as a potent chemoattractant for chronically activated counterparts. MDC/CCL22 Protein, Human (HEK293, Fc) is the recombinant human-derived MDC/CCL22 protein, expressed by HEK293, with C-hFc labeled tag.

Background

CCL22 (C-C Motif Chemokine Ligand 22) emerges as a crucial player in orchestrating the intricate trafficking patterns of activated/effector T-lymphocytes, steering them towards inflammatory sites and influencing various facets of activated T-lymphocyte physiology. Exhibiting chemotactic prowess for monocytes, dendritic cells, and natural killer cells, CCL22 serves as a mild chemoattractant for primary activated T-lymphocytes and a potent one for chronically activated counterparts. Notably, it lacks chemoattractant activity for neutrophils, eosinophils, and resting T-lymphocytes. The chemotactic effects of CCL22 are mediated through its binding to the CCR4 receptor. Interestingly, processed forms MDC(3-69), MDC(5-69), and MDC(7-69) appear to be inactive, adding a layer of complexity to its regulatory role in immune cell migration.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

O00626 (G25-Q93)

Gene ID

6367

Molecular Construction
N-term
CCL22 (G25-Q93)
Accession # O00626
hFc
C-term
Protein Length

Full Length of C-C motif chemokine 22

Synonyms
C-C motif chemokine 22; CCL22; MDC; SCYA22
AA Sequence

GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

Predicted Molecular Mass
34.5 kDa.
Molecular Weight

Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, 0.2 M Arginine, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MDC/CCL22 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MDC/CCL22 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MDC/CCL22 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P704783
Quantity:
MCE Japan Authorized Agent: