1. Protéines recombinantes
  2. Cytokines and Growth Factors
  3. MDK/Midkine Protein, Human (His-Avi)

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Prix Stock Quantité
Échantillon gratuit   Apply now
2 μg En stock
10 μg En stock
20 μg En stock
50 μg En stock
100 μg En stock
500 μg En stock
1 mg En stock
> 1 mg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE MDK/Midkine Protein, Human (His-Avi)

  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

  • Références

Description

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.

Background

Midkine (MDK) is a secreted protein that serves as a multifunctional cytokine and growth factor, transmitting signals through cell-surface proteoglycan and non-proteoglycan receptors. Engaging in various physiological processes, MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration. It plays a crucial role in inflammatory processes by mediating the recruitment of neutrophils and macrophages to inflammation sites, exhibiting dual activities that include promoting epithelial cell survival and facilitating smooth muscle cell migration following renal and vessel damage. Moreover, MDK suppresses the development of tolerogenic dendritic cells, inhibiting regulatory T cell differentiation and promoting T cell expansion through NFAT signaling and Th1 cell differentiation. MDK's involvement extends to tissue regeneration, contributing to heart damage recovery by negatively regulating inflammatory cell recruitment and mediating cell survival through MAPKs and AKT pathways, along with facilitating liver regeneration, bone repair, and brain development. Interactions with various receptors, such as PTPRZ1, ITGA4:ITGB1 complex, LRP1, and GPC2, underscore MDK's intricate regulatory role in diverse physiological processes.

Activité biologique

Measured by its ability to chemoattract macrophages cells. The ED50 for this effect is 6.419 ng/mL, corresponding to a specific activity is1.558×105 U/mg.

  • Measured by its ability to chemoattract macrophages cells. The ED50 for this effect is 6.419 ng/mL, corresponding to a specific activity is1.558×105 U/mg.
Species

Human

Source

E. coli

Tag

N-His;N-Avi

Accession

P21741-1 (V21-D143)

Gene ID
Molecular Construction
N-term
His-Avi
MDK (V21-D143)
Accession # P21741-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
MK; ARAP; MDK; MEK; MK1; MKARAP; NEGF2
AA Sequence

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Predicted Molecular Mass
16.5 kDa
Masse moléculaire

Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions.

Pureté
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Livraison

Room temperature in continental US; may vary elsewhere.

Documentation
Références

MDK/Midkine Protein, Human (His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

MDK/Midkine Protein, Human (His-Avi)

 

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

     

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
MDK/Midkine Protein, Human (His-Avi)
Cat. No.:
HY-P700791
Quantité:
MCE Japan Authorized Agent: