1. Recombinant Proteins
  2. Viral Proteins Biotinylated Proteins
  3. MERS-CoV Spike/S Protein RBD (Biotinylated, sf9, His)

MERS-CoV Spike/S Protein RBD (Biotinylated, sf9, His)

Cat. No.: HY-P74753
Handling Instructions Technical Support

The SARS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. The engagement of the MERS-CoV spike protein S1 with CD26 (also known as dipeptidyl peptidase 4, DPP4) mediates viral attachment to host cells and virus鈥揷ell fusion, thereby initiating infection. S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein and S2' is unmasked following S2 cleavage occurring upon virus endocytosis. MERS-CoV Spike/S Protein RBD (Biotinylated, sf9, His) is the recombinant Virus-derived MERS-CoV Spike/S protein RBD, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

The SARS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. The engagement of the MERS-CoV spike protein S1 with CD26 (also known as dipeptidyl peptidase 4, DPP4) mediates viral attachment to host cells and virus鈥揷ell fusion, thereby initiating infection. S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein and S2' is unmasked following S2 cleavage occurring upon virus endocytosis. MERS-CoV Spike/S Protein RBD (Biotinylated, sf9, His) is the recombinant Virus-derived MERS-CoV Spike/S protein RBD, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The MERS-CoV Spike glycoprotein (S) has three subunits S1, S2' and S2 through alternative splicing. S1 can attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. S2' acts as a viral fusion peptide which is unmasked following S2 cleavage occurring upon virus endocytosis. S2 mediates fusion of the virion and cellular membranes by acting as a class I viral fusion protein.
Under the current model, S protein has at least three conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.
The engagement of the MERS-CoV spike protein S1 with CD26 (also known as dipeptidyl peptidase 4, DPP4) mediates viral attachment to host cells and virus–cell fusion, thereby initiating infection[1].

Species

Virus

Source

Sf9 insect cells

Tag

C-His

Accession

K0BRG7/AFS88936.1 (E367-Y606)

Gene ID

14254594  [NCBI]

Molecular Construction
N-term
MERS-CoV Spike RBD (E367-Y606)
Accession # K0BRG7/AFS88936.1
His
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
Spike glycoprotein; S glycoprotein; E2; Peplomer protein; S
AA Sequence

EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEY

Predicted Molecular Mass
27.7 kDa
Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

MERS-CoV Spike/S Protein RBD (Biotinylated, sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MERS-CoV Spike/S Protein RBD (Biotinylated, sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MERS-CoV Spike/S Protein RBD (Biotinylated, sf9, His)
Cat. No.:
HY-P74753
Quantity:
MCE Japan Authorized Agent: