MPF Protein, Human (HEK293, His)
Based on 1 Customer Validation
Mesothelin Protein, especially in its membrane-anchored forms, potentially mediates cellular adhesion, implicating its role in cell interactions. Furthermore, the associated Megakaryocyte-potentiating factor (MPF) actively enhances in vitro megakaryocyte colony formation, indicating its participation in fostering specialized blood cell colonies' development. MPF Protein, Human (HEK293, His) is expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Mesothelin Protein, especially in its membrane-anchored forms, potentially mediates cellular adhesion, implicating its role in cell interactions. Furthermore, the associated Megakaryocyte-potentiating factor (MPF) actively enhances in vitro megakaryocyte colony formation, indicating its participation in fostering specialized blood cell colonies' development. MPF Protein, Human (HEK293, His) is expressed by HEK293 , with C-6*His labeled tag.
Background
Mesothelin Protein, particularly in its membrane-anchored forms, exhibits a potential role in cellular adhesion, suggesting involvement in mediating interactions between cells. Furthermore, the associated Megakaryocyte-potentiating factor (MPF) has been identified as a potent enhancer of megakaryocyte colony formation in vitro, indicating its active participation in fostering the development of these specialized blood cell colonies.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q13421-2 (L37-R286)
-
Molecular Construction
-
N-term
-
MPF (L37-R286)
Accession # Q13421-2 -
6*His
-
C-term
-
-
Protein Length
Full Length of Megakaryocyte-potentiating factor Chain
-
Synonyms
MSLN; CAK1; Mesothelin; Soluble MPF Mesothelin Related Protein; MPF; Megakaryocyte Potentiating Factor; Pre-Pro-Megakaryocyte-Potentiating Factor; SMRP; CAK1 Antigen
-
AA Sequence
LAGETGQEAAPLDGVLANPPNISSLSPRQLLGFPCAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPPSTWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPER
-
Predicted Molecular Mass
27.8 kDa
-
Molecular Weight
Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)