Mesothelin Protein, Mouse (HEK293, His)

Mesothelin Protein, in its membrane-anchored forms, is implicated in cellular adhesion, suggesting a potential role in mediating cell interactions. Additionally, Megakaryocyte-potentiating factor (MPF) enhances megakaryocyte colony formation, indicating its involvement in the development of these specialized blood cell colonies. Mesothelin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Mesothelin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Mesothelin Protein, Mouse (HEK293, His) is 303 a.a., with molecular weight of 38-55 kDa.

Mesothelin Protein, in its membrane-anchored forms, is implicated in cellular adhesion, suggesting a potential role in mediating interactions between cells. Additionally, Megakaryocyte-potentiating factor (MPF) has been associated with the enhancement of megakaryocyte colony formation, indicating its involvement in processes related to the development of these specialized blood cell colonies.

Mouse

HEK293

C-6*His

Q61468 (D298-S600)

56047  [NCBI]

DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS

38-55 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.