METAP1D/Methionine aminopeptidase 1D Protein, Human (His)

Customer Review

Based on 1 Customer Validation

METAP1D or methionine aminopeptidase 1D plays a crucial role in protein maturation, catalyzing the removal of N-terminal methionine from nascent proteins. Its activity is prominent in the smaller, uncharged second residue (Met-Ala, Cys, Gly, Pro, Ser, Thr or Val). METAP1D/Methionine aminopeptidase 1D Protein, Human (His) is the recombinant human-derived METAP1D/Methionine aminopeptidase 1D protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

METAP1D or methionine aminopeptidase 1D plays a crucial role in protein maturation, catalyzing the removal of N-terminal methionine from nascent proteins. Its activity is prominent in the smaller, uncharged second residue (Met-Ala, Cys, Gly, Pro, Ser, Thr or Val). METAP1D/Methionine aminopeptidase 1D Protein, Human (His) is the recombinant human-derived METAP1D/Methionine aminopeptidase 1D protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Background

METAP1D, known as Methionine aminopeptidase 1D, assumes a pivotal role in protein maturation by catalyzing the removal of the N-terminal methionine from nascent proteins. This enzymatic activity is particularly prevalent when the second residue in the primary sequence is small and uncharged, such as Met-Ala, Cys, Gly, Pro, Ser, Thr, or Val. Notably, METAP1D's function requires the prior deformylation of the Nα-formylated initiator methionine to enable subsequent hydrolysis. Beyond its role in protein biosynthesis, METAP1D may also be implicated in colon tumorigenesis, suggesting its involvement in broader cellular processes and potential implications in pathological conditions.

Verified Bioactivity

Measure by its ability to remove methionine from a fluorogenic peptide substrate H-Met-Gly-Pro-AMC. The resulting GP-AMC is cleaved by Recombinant Human DPPIV/CD26 (HY-P70017). The specific activity is 118.5348 pmol/min/µg. (Activation description: The enzyme needs to be activated in activation buffer.)

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His;C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • METAP1D (R44-A335)
      Accession # Q6UB28
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    METAP1D; Peptidase M 1D; Methionyl Aminopeptidase Type 1D, Mitochondrial; MetAP 1D; MAP1D; MAP 1D; Metap1l; CDS Of MetAP-3 Within PCR Fragment; Methionine Aminopeptidase 1D, Mitochondrial; Methionine Aminopeptidase 1D

  • AA Sequence

    RQRDISHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEA

  • Predicted Molecular Mass

    33.7 kDa

  • Molecular Weight

    Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00