METAP1D/Methionine aminopeptidase 1D Protein, Human (His)
Based on 1 Customer Validation
METAP1D or methionine aminopeptidase 1D plays a crucial role in protein maturation, catalyzing the removal of N-terminal methionine from nascent proteins. Its activity is prominent in the smaller, uncharged second residue (Met-Ala, Cys, Gly, Pro, Ser, Thr or Val). METAP1D/Methionine aminopeptidase 1D Protein, Human (His) is the recombinant human-derived METAP1D/Methionine aminopeptidase 1D protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
METAP1D or methionine aminopeptidase 1D plays a crucial role in protein maturation, catalyzing the removal of N-terminal methionine from nascent proteins. Its activity is prominent in the smaller, uncharged second residue (Met-Ala, Cys, Gly, Pro, Ser, Thr or Val). METAP1D/Methionine aminopeptidase 1D Protein, Human (His) is the recombinant human-derived METAP1D/Methionine aminopeptidase 1D protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.
Background
METAP1D, known as Methionine aminopeptidase 1D, assumes a pivotal role in protein maturation by catalyzing the removal of the N-terminal methionine from nascent proteins. This enzymatic activity is particularly prevalent when the second residue in the primary sequence is small and uncharged, such as Met-Ala, Cys, Gly, Pro, Ser, Thr, or Val. Notably, METAP1D's function requires the prior deformylation of the Nα-formylated initiator methionine to enable subsequent hydrolysis. Beyond its role in protein biosynthesis, METAP1D may also be implicated in colon tumorigenesis, suggesting its involvement in broader cellular processes and potential implications in pathological conditions.
Verified Bioactivity
Measure by its ability to remove methionine from a fluorogenic peptide substrate H-Met-Gly-Pro-AMC. The resulting GP-AMC is cleaved by Recombinant Human DPPIV/CD26 (HY-P70017). The specific activity is 118.5348 pmol/min/µg. (Activation description: The enzyme needs to be activated in activation buffer.)
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;C-6*His
-
Accession
Q6UB28 (R44-A335)
-
Molecular Construction
-
N-term
-
6*His
-
METAP1D (R44-A335)
Accession # Q6UB28 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
METAP1D; Peptidase M 1D; Methionyl Aminopeptidase Type 1D, Mitochondrial; MetAP 1D; MAP1D; MAP 1D; Metap1l; CDS Of MetAP-3 Within PCR Fragment; Methionine Aminopeptidase 1D, Mitochondrial; Methionine Aminopeptidase 1D
-
AA Sequence
RQRDISHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEA
-
Predicted Molecular Mass
33.7 kDa
-
Molecular Weight
Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)