1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. METAP1D/Methionine aminopeptidase 1D Protein, Human (His)

METAP1D/Methionine aminopeptidase 1D Protein, Human (His)

Cat. No.: HY-P70862
Handling Instructions

METAP1D or methionine aminopeptidase 1D plays a crucial role in protein maturation, catalyzing the removal of N-terminal methionine from nascent proteins. Its activity is prominent in the smaller, uncharged second residue (Met-Ala, Cys, Gly, Pro, Ser, Thr or Val). METAP1D/Methionine aminopeptidase 1D Protein, Human (His) is the recombinant human-derived METAP1D/Methionine aminopeptidase 1D protein, expressed by E. coli , with N-6*His, C-6*His labeled tag. The total length of METAP1D/Methionine aminopeptidase 1D Protein, Human (His) is 292 a.a., with molecular weight of 35-40 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

METAP1D or methionine aminopeptidase 1D plays a crucial role in protein maturation, catalyzing the removal of N-terminal methionine from nascent proteins. Its activity is prominent in the smaller, uncharged second residue (Met-Ala, Cys, Gly, Pro, Ser, Thr or Val). METAP1D/Methionine aminopeptidase 1D Protein, Human (His) is the recombinant human-derived METAP1D/Methionine aminopeptidase 1D protein, expressed by E. coli , with N-6*His, C-6*His labeled tag. The total length of METAP1D/Methionine aminopeptidase 1D Protein, Human (His) is 292 a.a., with molecular weight of 35-40 kDa.

Background

METAP1D, known as Methionine aminopeptidase 1D, assumes a pivotal role in protein maturation by catalyzing the removal of the N-terminal methionine from nascent proteins. This enzymatic activity is particularly prevalent when the second residue in the primary sequence is small and uncharged, such as Met-Ala, Cys, Gly, Pro, Ser, Thr, or Val. Notably, METAP1D's function requires the prior deformylation of the Nα-formylated initiator methionine to enable subsequent hydrolysis. Beyond its role in protein biosynthesis, METAP1D may also be implicated in colon tumorigenesis, suggesting its involvement in broader cellular processes and potential implications in pathological conditions.

Species

Human

Source

E. coli

Tag

N-6*His;C-6*His

Accession

Q6UB28 (R44-A335)

Gene ID
Molecular Construction
N-term
6*His
METAP1D (R44-A335)
Accession # Q6UB28
6*His
C-term
Synonyms
Methionine Aminopeptidase 1D Mitochondrial; Methionyl Aminopeptidase Type 1D Mitochondrial; METAP1D; MAP1D
AA Sequence

RQRDISHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEA

Molecular Weight

35-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

METAP1D/Methionine aminopeptidase 1D Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
METAP1D/Methionine aminopeptidase 1D Protein, Human (His)
Cat. No.:
HY-P70862
Quantity:
MCE Japan Authorized Agent: