MFG-E8 Protein, Human (sf9, His)
Based on 1 Customer Validation
MFG-E8 Protein plays a crucial role in maintaining intestinal epithelial homeostasis, facilitating mucosal healing, and contributing to VEGF-dependent neovascularization. It acts as a specific ligand, binding to alpha-v/beta-3 and alpha-v/beta-5 receptors, and participates in the phagocytic removal of apoptotic cells. The protein is also implicated in zona pellucida binding and is a major component of aortic medial amyloid. MFG-E8 Protein, Human (sf9, His) is the recombinant human-derived MFG-E8 protein, expressed by Sf9 insect cells , with C-10*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
MFG-E8 Protein plays a crucial role in maintaining intestinal epithelial homeostasis, facilitating mucosal healing, and contributing to VEGF-dependent neovascularization. It acts as a specific ligand, binding to alpha-v/beta-3 and alpha-v/beta-5 receptors, and participates in the phagocytic removal of apoptotic cells. The protein is also implicated in zona pellucida binding and is a major component of aortic medial amyloid. MFG-E8 Protein, Human (sf9, His) is the recombinant human-derived MFG-E8 protein, expressed by Sf9 insect cells , with C-10*His labeled tag.
The MFG-E8 protein is involved in multiple essential functions, including the maintenance of intestinal epithelial homeostasis and the facilitation of mucosal healing. It aids in VEGF-dependent neovascularization and contributes to the phagocytic removal of apoptotic cells in various tissues. Acting as a specific ligand, it binds to the alpha-v/beta-3 and alpha-v/beta-5 receptors, and it also has the ability to bind to cell surfaces enriched with phosphatidylserine, independently of receptors. Furthermore, it serves as a zona pellucida-binding protein that potentially plays a role in gamete interaction. Additionally, the MFG-E8 protein is a main constituent of aortic medial amyloid.
1. When 5 x 104cells/well are added to Recombinant Human MFG-E8 coated plates (12.5 μg/mL, 100 μL/well), 45-93% cells will adhere after 1 hour at 37 °C.
2. Measured by the ability of the immobilized protein to support the adhesion of SVEC4 10 mouse vascular endothelial cells. When 5 x 104 cells/well are added to Recombinant Human MFG E8 coated plates (10 µg/mL, 100 µL/well), approximately 62.626% will adhere.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q08431-1 (L24-C387)
-
Molecular Construction
-
N-term
-
MFG-E8 (L24-C387)
Accession # Q08431-1 -
10*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Synonyms
MFGE8; HP47; Prev. SPAG10; Breast Epithelial Antigen BA46; MFG-E8; Sperm Associated Antigen 10; SED1; Sperm Surface Protein HP47; Lactadherin; HMFG; HsT19888; MFGM; OAcGD3S; O-Acetyl Disialoganglioside Synthase; EDIL1; Milk Fat Globule-EGF Factor 8; BA46;
-
AA Sequence
LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC
-
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 0.2M arg, 0.01% Tween-20, pH 7.2, 22.5% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
