1. Recombinant Proteins
  2. Others
  3. MFG-E8 Protein, Human (sf9, His)

MFG-E8 Protein, Human (sf9, His)

Cat. No.: HY-P73815
COA Handling Instructions

MFG-E8 Protein plays a crucial role in maintaining intestinal epithelial homeostasis, facilitating mucosal healing, and contributing to VEGF-dependent neovascularization. It acts as a specific ligand, binding to alpha-v/beta-3 and alpha-v/beta-5 receptors, and participates in the phagocytic removal of apoptotic cells. The protein is also implicated in zona pellucida binding and is a major component of aortic medial amyloid. MFG-E8 Protein, Human (sf9, His) is the recombinant human-derived MFG-E8 protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of MFG-E8 Protein, Human (sf9, His) is 364 a.a., with molecular weight of ~45 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
50 μg $495 In-stock
100 μg $845 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MFG-E8 Protein plays a crucial role in maintaining intestinal epithelial homeostasis, facilitating mucosal healing, and contributing to VEGF-dependent neovascularization. It acts as a specific ligand, binding to alpha-v/beta-3 and alpha-v/beta-5 receptors, and participates in the phagocytic removal of apoptotic cells. The protein is also implicated in zona pellucida binding and is a major component of aortic medial amyloid. MFG-E8 Protein, Human (sf9, His) is the recombinant human-derived MFG-E8 protein, expressed by Sf9 insect cells , with C-His labeled tag. The total length of MFG-E8 Protein, Human (sf9, His) is 364 a.a., with molecular weight of ~45 kDa.

Background

The MFG-E8 protein is involved in multiple essential functions, including the maintenance of intestinal epithelial homeostasis and the facilitation of mucosal healing. It aids in VEGF-dependent neovascularization and contributes to the phagocytic removal of apoptotic cells in various tissues. Acting as a specific ligand, it binds to the alpha-v/beta-3 and alpha-v/beta-5 receptors, and it also has the ability to bind to cell surfaces enriched with phosphatidylserine, independently of receptors. Furthermore, it serves as a zona pellucida-binding protein that potentially plays a role in gamete interaction. Additionally, the MFG-E8 protein is a main constituent of aortic medial amyloid.

Biological Activity

When 5 x 10E4 cells/well are added to Recombinant Human MFG-E8 coated plates (12.5 μg/mL, 100 μL/well), 45-93% cells will adhere after 1 hour at 37℃.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

Q08431 (L24-C387)

Gene ID
Molecular Construction
N-term
MFG-E8 (L24-C387)
Accession # Q08431
His
C-term
Synonyms
Lactadherin; HMFG; MFGM; MFG-E8; SED1
AA Sequence

LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC

Molecular Weight

Approximately 45 kDa

Purity

Greater than 80% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% Glycerol. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MFG-E8 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MFG-E8 Protein, Human (sf9, His)
Cat. No.:
HY-P73815
Quantity:
MCE Japan Authorized Agent: