MFG-E8 Protein, Human (sf9, His)

MFG-E8 Protein plays a crucial role in maintaining intestinal epithelial homeostasis, facilitating mucosal healing, and contributing to VEGF-dependent neovascularization. It acts as a specific ligand, binding to alpha-v/beta-3 and alpha-v/beta-5 receptors, and participates in the phagocytic removal of apoptotic cells. The protein is also implicated in zona pellucida binding and is a major component of aortic medial amyloid. MFG-E8 Protein, Human (sf9, His) is the recombinant human-derived MFG-E8 protein, expressed by Sf9 insect cells , with C-10*His labeled tag.

The MFG-E8 protein is involved in multiple essential functions, including the maintenance of intestinal epithelial homeostasis and the facilitation of mucosal healing. It aids in VEGF-dependent neovascularization and contributes to the phagocytic removal of apoptotic cells in various tissues. Acting as a specific ligand, it binds to the alpha-v/beta-3 and alpha-v/beta-5 receptors, and it also has the ability to bind to cell surfaces enriched with phosphatidylserine, independently of receptors. Furthermore, it serves as a zona pellucida-binding protein that potentially plays a role in gamete interaction. Additionally, the MFG-E8 protein is a main constituent of aortic medial amyloid.

1. When 5 x 10⁴cells/well are added to Recombinant Human MFG-E8 coated plates (12.5 μg/mL, 100 μL/well), 45-93% cells will adhere after 1 hour at 37 °C.
2. Measured by the ability of the immobilized protein to support the adhesion of SVEC4 10 mouse vascular endothelial cells. When 5 x 10⁴ cells/well are added to Recombinant Human MFG E8 coated plates (10 µg/mL, 100 µL/well), approximately 62.626% will adhere.

Human

Sf9 insect cells

C-His

Q08431-1 (L24-C387)

4240  [NCBI]

Full Length of Isoform-1 Mature Protein

LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC

Approximately 40-45 kDa, based on SDS-PAGE under reducing condition, due to the glycosylation.

• 
  ≥ 80%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, 0.2M arg, 0.01% Tween-20, pH 7.2, 22.5% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.