1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. MGMT Protein, Human (His)

MGMT Protein crucially defends against O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA, using a suicide reaction to repair methylated nucleobases. It stoichiometrically transfers the methyl group to a cysteine residue, but this process irreversibly inactivates MGMT. The sacrificial nature of MGMT's function emphasizes its commitment to safeguarding cellular DNA integrity at the expense of its own activity. MGMT Protein, Human (His) is the recombinant human-derived MGMT protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MGMT Protein crucially defends against O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA, using a suicide reaction to repair methylated nucleobases. It stoichiometrically transfers the methyl group to a cysteine residue, but this process irreversibly inactivates MGMT. The sacrificial nature of MGMT's function emphasizes its commitment to safeguarding cellular DNA integrity at the expense of its own activity. MGMT Protein, Human (His) is the recombinant human-derived MGMT protein, expressed by E. coli , with N-6*His labeled tag.

Background

The MGMT Protein plays a crucial role in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Operating through a suicide reaction, MGMT repairs the methylated nucleobases in DNA by stoichiometrically transferring the methyl group to a cysteine residue within the enzyme. However, this repair process results in the irreversible inactivation of the MGMT Protein. This unique mechanism underscores the sacrificial nature of MGMT's function, emphasizing its commitment to safeguarding cellular DNA integrity at the expense of its own activity.

Biological Activity

Human MGMT immobilized on CM5 Chip can bind O6-Benzylguanine with an affinity constant of 953.8 μM as determined in a SPR assay.

  • Human MGMT immobilized on CM5 Chip can bind O^6-Benzylguanine with an affinity constant of 953.8 μM as determined in a SPR assay.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P16455 (M1-N207)

Gene ID
Molecular Construction
N-term
6*His
MGMT (M1-N207)
Accession # P16455
C-term
Protein Length

Full Length

Synonyms
rHuMethylated-DNA--protein-cysteine methyltransferase/MGMT, His; Methylated-DNA--protein-cysteine methyltransferase; 6-O-methylguanine-DNAmethyltransferase; O-6-methylguanine-DNA-alkyltransferase; MGMT
AA Sequence

MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

Molecular Weight

Approximately 24.0-26.0 kDa

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl,1 mM DTT,1 mM EDTA,500 mM NaCl,0.1% Trition X-100, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

MGMT Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MGMT Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MGMT Protein, Human (His)
Cat. No.:
HY-P70306
Quantity:
MCE Japan Authorized Agent: