MGMT Protein, Human (His)

Customer Review

Based on 1 Customer Validation

MGMT Protein crucially defends against O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA, using a suicide reaction to repair methylated nucleobases. It stoichiometrically transfers the methyl group to a cysteine residue, but this process irreversibly inactivates MGMT. The sacrificial nature of MGMT's function emphasizes its commitment to safeguarding cellular DNA integrity at the expense of its own activity. MGMT Protein, Human (His) is the recombinant human-derived MGMT protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

MGMT Protein crucially defends against O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA, using a suicide reaction to repair methylated nucleobases. It stoichiometrically transfers the methyl group to a cysteine residue, but this process irreversibly inactivates MGMT. The sacrificial nature of MGMT's function emphasizes its commitment to safeguarding cellular DNA integrity at the expense of its own activity. MGMT Protein, Human (His) is the recombinant human-derived MGMT protein, expressed by E. coli , with N-6*His labeled tag.

Background

The MGMT Protein plays a crucial role in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Operating through a suicide reaction, MGMT repairs the methylated nucleobases in DNA by stoichiometrically transferring the methyl group to a cysteine residue within the enzyme. However, this repair process results in the irreversible inactivation of the MGMT Protein. This unique mechanism underscores the sacrificial nature of MGMT's function, emphasizing its commitment to safeguarding cellular DNA integrity at the expense of its own activity.

Verified Bioactivity

Human MGMT immobilized on CM5 Chip can bind O6-Benzylguanine with an affinity constant of 953.8 μM as determined in a SPR assay.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - SPR

    Bioactivity - SPR

    Human MGMT immobilized on CM5 Chip can bind O^6-Benzylguanine with an affinity constant of 953.8 μM as determined in a SPR assay.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • MGMT (M1-N207)
      Accession # P16455
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    MGMT; O-6-Methylguanine-DNA-Alkyltransferase; O-6-Methylguanine-DNA Methyltransferase; O6-Methylguanine-DNA Methyltransferase; Methylated-DNA--Protein-Cysteine Methyltransferase; Methylguanine-DNA Methyltransferase; 6-O-Methylguanine-DNA Methyltransferase

  • AA Sequence

    MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

  • Molecular Weight

    Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl,1 mM DTT,1 mM EDTA,500 mM NaCl,0.1% Trition X-100, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00