1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. MGMT Protein, Human (His)

MGMT Protein, Human (His)

Cat. No.: HY-P70306
COA Handling Instructions

MGMT Protein crucially defends against O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA, using a suicide reaction to repair methylated nucleobases. It stoichiometrically transfers the methyl group to a cysteine residue, but this process irreversibly inactivates MGMT. The sacrificial nature of MGMT's function emphasizes its commitment to safeguarding cellular DNA integrity at the expense of its own activity. MGMT Protein, Human (His) is the recombinant human-derived MGMT protein, expressed by E. coli , with N-6*His labeled tag. The total length of MGMT Protein, Human (His) is 207 a.a., with molecular weight of ~27.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $100 In-stock
50 μg $280 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MGMT Protein crucially defends against O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA, using a suicide reaction to repair methylated nucleobases. It stoichiometrically transfers the methyl group to a cysteine residue, but this process irreversibly inactivates MGMT. The sacrificial nature of MGMT's function emphasizes its commitment to safeguarding cellular DNA integrity at the expense of its own activity. MGMT Protein, Human (His) is the recombinant human-derived MGMT protein, expressed by E. coli , with N-6*His labeled tag. The total length of MGMT Protein, Human (His) is 207 a.a., with molecular weight of ~27.0 kDa.

Background

The MGMT Protein plays a crucial role in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Operating through a suicide reaction, MGMT repairs the methylated nucleobases in DNA by stoichiometrically transferring the methyl group to a cysteine residue within the enzyme. However, this repair process results in the irreversible inactivation of the MGMT Protein. This unique mechanism underscores the sacrificial nature of MGMT's function, emphasizing its commitment to safeguarding cellular DNA integrity at the expense of its own activity.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P16455 (M1-N207)

Gene ID
Molecular Construction
N-term
6*His
MGMT (M1-N207)
Accession # P16455
C-term
Synonyms
rHuMethylated-DNA--protein-cysteine methyltransferase/MGMT, His; Methylated-DNA--protein-cysteine methyltransferase; 6-O-methylguanine-DNAmethyltransferase; O-6-methylguanine-DNA-alkyltransferase; MGMT
AA Sequence

MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

Molecular Weight

Approximately 27.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl,1 mM DTT,1 mM EDTA,500 mM NaCl,0.1% Trition X-100, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

MGMT Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MGMT Protein, Human (His)
Cat. No.:
HY-P70306
Quantity:
MCE Japan Authorized Agent: