1. Recombinant Proteins
  2. Others
  3. MICA Protein, Human (HEK293, Fc)

MICA Protein, Human (HEK293, Fc)

Cat. No.: HY-P70579
COA Handling Instructions

MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, Fc) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-hFc labeled tag. The total length of MICA Protein, Human (HEK293, Fc) is 285 a.a., with molecular weight of 85-110 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $100 In-stock
50 μg $280 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MICA is a ligand for the stress signaling protein and natural killer (NK) cell activating receptor KLRK1/NKG2D. Tumor cells shed the expressed MICA protein and undergo immune evasion. MICA Protein, Human (HEK293, Fc) is the recombinant human-derived MICA protein, expressed by HEK293 , with C-hFc labeled tag. The total length of MICA Protein, Human (HEK293, Fc) is 285 a.a., with molecular weight of 85-110 kDa.

Background

MICA is an MHC class I chain-associated protein and a ligand for the stress signaling protein and natural killer (NK) cell-activating receptor KLRK1/NKG2D. MICA serves as a stress-induced autoantigen recognized by γδ T cells. Tumor cells escape by shedding overexpressed MICA, disrupting the biological function of NKG2D. CRC patients with high MICA expression have poor prognosis. In patients with head and neck squamous cell carcinoma (HNSCC) receiving curative chemoradiotherapy (CRT), persistently elevated levels of soluble MICA-related sequences and TGF-β1 mark a higher risk of tumor progression or death.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

AAH16929.1 (E24-Q308)

Gene ID
Molecular Construction
N-term
MICA (E24-Q308)
Accession # AAH16929.1
hFc
C-term
Synonyms
MHC Class I Polypeptide-Related Sequence A; MIC-A; MICA; PERB11.1
AA Sequence

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Molecular Weight

85-110 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

MICA Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MICA Protein, Human (HEK293, Fc)
Cat. No.:
HY-P70579
Quantity:
MCE Japan Authorized Agent: