MICA Protein, Human (HEK293, mFc)

MICA is the gene for major histocompatibility complex class I chain-associated protein A, encoding a highly polymorphic cell surface protein. Unlike traditional class I molecules, it lacks beta-2-microglobulin association. MICA Protein, Human (HEK293, mFc) is the recombinant human-derived MICA protein, expressed by HEK293 , with N-mFc labeled tag.

MICA, the gene encoding the major histocompatibility complex class I chain-related protein A, produces a highly polymorphic protein expressed on the cell surface. Unlike conventional class I molecules, it does not appear to associate with beta-2-microglobulin. Functioning as a ligand for the NKG2-D type II integral membrane protein receptor, this protein acts as a stress-induced antigen recognized by intestinal epithelial gamma delta T cells. Genetic variations in MICA have been linked to susceptibility to psoriasis 1 and psoriatic arthritis. The shedding of MICA-related antibodies and ligands is implicated in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene yields multiple transcript variants. MICA demonstrates ubiquitous expression, with notable levels observed in the lung (RPKM 8.7), endometrium (RPKM 7.4), and 25 other tissues.

Immobilized Human MICA alpha 3, mFc Tag at 2μg/ml (100μl/well) on the plate. Dose response curve for Anti-MICA Antibody, hFc Tag with the EC₅₀ of ≤0.13 μg/ml determined by ELISA.

Human

HEK293

N-mFc

NP_001276081.1 (R105-S200)

100507436  [NCBI]

Partial

RRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPS

50-65 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/mrc5-cell.html  [Content Brief]