1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. MIF Protein, Human (HEK293, hFc)

MIF Protein, Human (HEK293, hFc)

Cat. No.: HY-P700425
Handling Instructions

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF counteracts the anti-inflammatory effects of glucocorticoids. Although MIF exhibits tautomerase activity in vitro, its physiological substrates remain unknown, and the relevance of this activity to its cytokine function is unclear. MIF Protein, Human (HEK293, hFc) is the recombinant human-derived MIF protein, expressed by HEK293, with C-hFc labeled tag. The total length of MIF Protein, Human (HEK293, hFc) is 114 a.a., with molecular weight of 41.3 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF counteracts the anti-inflammatory effects of glucocorticoids. Although MIF exhibits tautomerase activity in vitro, its physiological substrates remain unknown, and the relevance of this activity to its cytokine function is unclear. MIF Protein, Human (HEK293, hFc) is the recombinant human-derived MIF protein, expressed by HEK293, with C-hFc labeled tag. The total length of MIF Protein, Human (HEK293, hFc) is 114 a.a., with molecular weight of 41.3 kDa.

Background

MIF Protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens. Its expression at sites of inflammation suggests its involvement in regulating macrophage function in host defense. MIF counteracts the anti-inflammatory effects of glucocorticoids. Although MIF has phenylpyruvate tautomerase and dopachrome tautomerase activity in vitro, the physiological substrate of MIF is still unknown. It remains unclear whether the tautomerase activity is relevant to its cytokine activity.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P14174 (P2-A115)

Gene ID
Molecular Construction
N-term
MIF (P2-A115)
Accession # P14174
hFc
C-term
Synonyms
MIF; macrophage migration inhibitory factor; GIF; GLIF; MMIF; phenylpyruvate tautomerase; glycosylation-inhibiting factor; EC 5.3.2.1; Glycosylation-inhibiting factor; Phenylpyruvate tautomerase
AA Sequence

PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Molecular Weight

41.3 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MIF Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIF Protein, Human (HEK293, hFc)
Cat. No.:
HY-P700425
Quantity:
MCE Japan Authorized Agent: