MIP-2/CXCL2 Protein, Mouse (His)
MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived MIP-2/CXCL2 protein, expressed by E.coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst.Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals.MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived MIP-2/CXCL2 protein, expressed by E.coli , with N-6*His labeled tag.
MIP-2/CXCL2 protein acts as a chemotactic factor specifically for human polymorphonuclear leukocytes, with the distinctive characteristic of not inducing chemokinesis or an oxidative burst in these cells. Its chemotactic function underscores its role in orchestrating the directed migration of polymorphonuclear leukocytes, contributing to their recruitment to specific sites in response to inflammatory signals. Notably, MIP-2/CXCL2 exists as a homotetramer, emphasizing its structural composition and potential implications for its biological activity in the regulation of immune responses and inflammatory processes.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P10889 (A28-N100)
-
Molecular Construction
-
N-term
-
6*His
-
CXCL2 (A28-N100)
Accession # P10889 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CXCL2; Growth-Regulated Protein Beta; Prev. GRO2; GRO2 Oncogene; SCYB2; MIP2-Alpha; CINC-2a; Gro-Beta; MGSA-B; MIP2A; MIP-2a; Melanoma Growth Stimulatory Activity Beta; GROb; MGSA Beta; Macrophage Inflammatory Protein 2-Alpha; MIP2; Chemokine (C-X-C Motif
-
AA Sequence
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
-
Predicted Molecular Mass
11.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
