2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. Chemokine & Receptors
  5. CXC Chemokines
  6. MIP-2/GRO-beta
  7. MIP-2/CXCL2 Protein, Mouse (His)

MIP-2/CXCL2 Protein, Mouse (His)

Cat. No.: HY-P700534
Handling Instructions

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst. Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals. MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived MIP-2/CXCL2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of MIP-2/CXCL2 Protein, Mouse (His) is 73 a.a., with molecular weight of 11.8 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MIP-2/CXCL2 protein selectively attracts polymorphonuclear leukocytes without inducing chemotaxis or oxidative burst. Its chemotactic function coordinates the directional migration of polymorphonuclear leukocytes and contributes to their recruitment in response to inflammatory signals. MIP-2/CXCL2 Protein, Mouse (His) is the recombinant mouse-derived MIP-2/CXCL2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of MIP-2/CXCL2 Protein, Mouse (His) is 73 a.a., with molecular weight of 11.8 kDa.
Background

MIP-2/CXCL2 protein acts as a chemotactic factor specifically for human polymorphonuclear leukocytes, with the distinctive characteristic of not inducing chemokinesis or an oxidative burst in these cells. Its chemotactic function underscores its role in orchestrating the directed migration of polymorphonuclear leukocytes, contributing to their recruitment to specific sites in response to inflammatory signals. Notably, MIP-2/CXCL2 exists as a homotetramer, emphasizing its structural composition and potential implications for its biological activity in the regulation of immune responses and inflammatory processes.
Species

Mouse
Source

E. coli
Tag

N-6*His
Accession

P10889 (A28-N100)
Gene ID

20310  [NCBI]
Molecular Construction
N-term
6*His
CXCL2 (A28-N100)
Accession # P10889
C-term
Synonyms
rHuGRO-β/CXCL2; C-X-C motif chemokine 2; MIP2-alpha; HSF
AA Sequence

AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

Molecular Weight

11.8 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

MIP-2/CXCL2 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIP-2/CXCL2 Protein, Mouse (His)
Cat. No.:
HY-P700534
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.