MMP-9 Protein, Human (Biotinylated, HEK293, His-Avi)

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in localized extracellular matrix breakdown, facilitating leukocyte migration. Its potential involvement in bone osteoclastic resorption is suggested. MMP-9 cleaves KiSS1 and NINJ1, generating their secreted forms. It degrades type IV and type V collagen, producing distinct fragments, and fibronectin, while laminin and Pz-peptide remain unaffected. MMP-9 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of MMP-9 Protein, Human (Biotinylated, HEK293, His-Avi) is 688 a.a., with molecular weight of 95-105 kDa.

MMP-9 protein, a matrix metalloproteinase, plays a crucial role in the localized breakdown of the extracellular matrix and facilitates leukocyte migration. It has been suggested that MMP-9 may also be involved in bone osteoclastic resorption. Additionally, MMP-9 cleaves KiSS1 at a Gly-|-Leu bond and NINJ1 to generate the secreted form of ninjurin-1. Furthermore, it is known to cleave type IV and type V collagen, resulting in the production of large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. While MMP-9 degrades fibronectin, it does not have an impact on laminin or Pz-peptide.

1. Immobilized Biotinylated Human MMP-9 His at 0.5 μg/mL (100 μL/Well) on the plate. Dose response curve for Anti-MMP-9 Antibody hFc with the EC₅₀ of 28.8 ng/mL determined by ELISA.
2. Immobilized Anti-MMP-9 Antibody, hFc Tag at 0.5 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human MMP-9, His Tag with the EC₅₀ of 14.3 ng/mL determined by ELISA.

Human

HEK293

C-Avi;C-His

P14780 (A20-D707)

4318  [NCBI]

APRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

95-105 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 5% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.