MOB4 Protein, Human (His)
Based on 1 Customer Validation
The MOB4 protein may be involved in membrane trafficking, specifically the membrane budding reaction, highlighting its role in vesicle formation and trafficking.MOB4 interacts with STRN4, suggesting involvement in protein-protein interactions.MOB4 Protein, Human (His) is the recombinant human-derived MOB4 protein, expressed by E.coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The MOB4 protein may be involved in membrane trafficking, specifically the membrane budding reaction, highlighting its role in vesicle formation and trafficking.MOB4 interacts with STRN4, suggesting involvement in protein-protein interactions.MOB4 Protein, Human (His) is the recombinant human-derived MOB4 protein, expressed by E.coli , with N-6*His labeled tag.
The MOB4 protein is suggested to potentially play a role in membrane trafficking, with a specific involvement in membrane budding reactions, indicating its significance in cellular processes related to vesicle formation and transport. Functionally, MOB4 has been identified to bind STRN4, suggesting a potential role in protein-protein interactions crucial for its cellular functions. Additionally, MOB4 interacts with DNM1 and EPS15, further highlighting its involvement in dynamic cellular processes associated with membrane dynamics. Moreover, MOB4 forms part of a ternary complex containing STRN and/or STRN3 and PPA2, indicating its participation in multi-protein complexes that may regulate membrane-related activities. The protein also interacts with nucleoside diphosphate kinase and binds STRN and STRN3, underscoring its versatility in engaging with various molecular partners. Furthermore, MOB4 interacts with CTTNBP2 and CTTNBP2NL, emphasizing its potential role in diverse cellular pathways and the intricate regulation of membrane-associated events. The detailed molecular interactions and specific functions of MOB4 in membrane trafficking warrant further exploration.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9Y3A3 (M1-A225)
-
Molecular Construction
-
N-term
-
6*His
-
MOB4 (M1-A225)
Accession # Q9Y3A3 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
MOB4; MOB-Like Protein Phocein; Prev. MOBKL3; Mob1 Homolog 3; Prev. PREI3; DKFZP564M112; PHOCN; CDNA FLJ52887, Highly Similar To Preimplantation Protein 3; MOB3; MOB1, Mps One Binder Kinase Activator-Like 3 (Yeast); 2C4D; MOB1, Mps One Binder Kinase Activ
-
AA Sequence
MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA
-
Predicted Molecular Mass
28.2 kDa
-
Molecular Weight
Approximately 27-33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 1 mM DTT, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
