MOB4A/MOB1B Protein, Human (His)

In the Hippo signaling pathway, MOB4A/MOB1B is a key activator that controls organ size and suppresses tumors by regulating proliferation and promoting apoptosis. This pathway involves a kinase cascade in which STK3/MST2 and STK4/MST1 together with the regulatory protein SAV1 activate LATS1/2. MOB4A/MOB1B Protein, Human (His) is the recombinant human-derived MOB4A/MOB1B protein, expressed by E. coli , with N-6*His labeled tag.

MOB4A, also known as MOB1B, functions as a crucial activator within the Hippo signaling pathway, playing a pivotal role in the control of organ size and tumor suppression by regulating proliferation and promoting apoptosis. The core of this pathway involves a kinase cascade, where STK3/MST2 and STK4/MST1, along with the regulatory protein SAV1, phosphorylate and activate LATS1/2. In conjunction with its regulatory partner MOB1B, LATS1/2 then phosphorylates and inactivates the YAP1 oncoprotein and WWTR1/TAZ. The phosphorylation of YAP1 by LATS1/2 prevents its translocation into the nucleus, thereby orchestrating the regulation of genes essential for cell proliferation, death, and migration. MOB4A/MOB1B also stimulates the kinase activity of STK38L and interacts with LATS1 and LATS2, contributing to the intricate regulatory network that governs the Hippo signaling pathway.

Human

E. coli

N-6*His

Q7L9L4-1 (M1-R216)

92597  [NCBI]

Full Length of Isoform-1

MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR

Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.