MOB4A/MOB1B Protein, Human (His)
Based on 1 Customer Validation
In the Hippo signaling pathway, MOB4A/MOB1B is a key activator that controls organ size and suppresses tumors by regulating proliferation and promoting apoptosis. This pathway involves a kinase cascade in which STK3/MST2 and STK4/MST1 together with the regulatory protein SAV1 activate LATS1/2. MOB4A/MOB1B Protein, Human (His) is the recombinant human-derived MOB4A/MOB1B protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
In the Hippo signaling pathway, MOB4A/MOB1B is a key activator that controls organ size and suppresses tumors by regulating proliferation and promoting apoptosis. This pathway involves a kinase cascade in which STK3/MST2 and STK4/MST1 together with the regulatory protein SAV1 activate LATS1/2. MOB4A/MOB1B Protein, Human (His) is the recombinant human-derived MOB4A/MOB1B protein, expressed by E. coli , with N-6*His labeled tag.
Background
MOB4A, also known as MOB1B, functions as a crucial activator within the Hippo signaling pathway, playing a pivotal role in the control of organ size and tumor suppression by regulating proliferation and promoting apoptosis. The core of this pathway involves a kinase cascade, where STK3/MST2 and STK4/MST1, along with the regulatory protein SAV1, phosphorylate and activate LATS1/2. In conjunction with its regulatory partner MOB1B, LATS1/2 then phosphorylates and inactivates the YAP1 oncoprotein and WWTR1/TAZ. The phosphorylation of YAP1 by LATS1/2 prevents its translocation into the nucleus, thereby orchestrating the regulation of genes essential for cell proliferation, death, and migration. MOB4A/MOB1B also stimulates the kinase activity of STK38L and interacts with LATS1 and LATS2, contributing to the intricate regulatory network that governs the Hippo signaling pathway.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q7L9L4-1 (M1-R216)
-
Molecular Construction
-
N-term
-
6*His
-
MOB1B (M1-R216)
Accession # Q7L9L4-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MOB1B; MOB1, Mps One Binder Kinase Activator-Like 1A (Yeast); Prev. MOBKL1A; MOB1 Mps One Binder Homolog B (Yeast); MOB4A; MOB1 Mps One Binder Homolog B; Mps One Binder Kinase Activator-Like 1A; Mob4A Protein; Mob1 Homolog 1A; MATS2; Mob1A; Mob1B; MOB Kin
-
AA Sequence
MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR
-
Predicted Molecular Mass
25.1 kDa
-
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)