MOB4A/MOB1B Protein, Human (His)

In the Hippo signaling pathway, MOB4A/MOB1B, a crucial activator, controls organ size and suppresses tumors by regulating proliferation and promoting apoptosis. This pathway involves a kinase cascade where STK3/MST2 and STK4/MST1, with the regulatory protein SAV1, activate LATS1/2. In partnership with its regulator MOB1B, LATS1/2 phosphorylates and inactivates YAP1 and WWTR1/TAZ, influencing gene expression. MOB4A/MOB1B stimulates STK38L and interacts with LATS1 and LATS2, contributing to the complex regulatory network within the Hippo signaling pathway. MOB4A/MOB1B Protein, Human (His) is the recombinant human-derived MOB4A/MOB1B protein, expressed by E. coli, with N-6*His labeled tag. The total length of MOB4A/MOB1B Protein, Human (His) is 216 a.a., with molecular weight of 43-48 kDa.

MOB4A, also known as MOB1B, functions as a crucial activator within the Hippo signaling pathway, playing a pivotal role in the control of organ size and tumor suppression by regulating proliferation and promoting apoptosis. The core of this pathway involves a kinase cascade, where STK3/MST2 and STK4/MST1, along with the regulatory protein SAV1, phosphorylate and activate LATS1/2. In conjunction with its regulatory partner MOB1B, LATS1/2 then phosphorylates and inactivates the YAP1 oncoprotein and WWTR1/TAZ. The phosphorylation of YAP1 by LATS1/2 prevents its translocation into the nucleus, thereby orchestrating the regulation of genes essential for cell proliferation, death, and migration. MOB4A/MOB1B also stimulates the kinase activity of STK38L and interacts with LATS1 and LATS2, contributing to the intricate regulatory network that governs the Hippo signaling pathway.

Human

E. coli

N-6*His

Q7L9L4 (M1-R216)

92597  [NCBI]

MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR

Approximately 24 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.